KEGG   Citrus sinensis (Valencia orange): 102609223Help
Entry
102609223         CDS       T02983                                 

Definition
(RefSeq) NADH--cytochrome b5 reductase 1-like
  KO
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cit00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    102609223
Enzymes [BR:cit01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     102609223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
7
AA seq 277 aa AA seqDB search
MQMQVSQAAFFGLLVAVAAMIITIVVYLCSIKKSRGSLDPENFKEFKLTKRTPISHNTAK
FRFALPKSTSILGLPVGQHILCRGKDSEGNEVIRPYTPITLDSDIGYFELVVKMYPKGRM
SHHFREMHEGEYLPVKGPKGRLKYKVGQARAFGMIAGGTGITPMFQLTRAILENPKDKTN
VHLIYANVTVGDILLKDELDSFATNFPNRFKVYYVLSQPTEVWNGGIGHVSKEMIQMHCP
TPAPDIQILRCGPPGMNKAMADHLNALGYTLDMQFEF
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatgcaagtttctcaagctgcgttttttggacttttggttgcggttgctgcaatg
atcatcacaattgttgtctatctttgttctatcaaaaaatccagaggcagcttagaccct
gagaatttcaaagaattcaaacttactaaaagaacaccaatcagtcataatactgcaaag
ttcagatttgcacttccaaaatccacttcaatattgggtcttcctgttggacaacatata
ctttgcagggggaaagacagtgaaggtaatgaagttattagaccatatactccaataact
ttggattctgatattggttactttgaactagttgttaagatgtatccgaaaggaagaatg
tctcaccatttcagagagatgcatgaaggagaataccttccagtaaagggacccaagggg
cgcctcaaatataaagttgggcaagctcgagcatttgggatgattgctggaggcactggc
attactccaatgtttcagctcacgcgagccattttagagaaccctaaagacaagaccaat
gtgcatctcatctatgctaatgttacagttggagacattcttctgaaggacgaacttgat
agctttgccacgaacttcccaaaccgtttcaaagtgtactacgttttgagccagcccact
gaagtgtggaatggtgggattggtcatgtgtccaaggaaatgattcagatgcattgtccc
acaccagcccctgatattcagatattgagatgtggacctccgggcatgaacaaagccatg
gctgatcatcttaatgcacttggatacacattagacatgcaatttgagttctga

DBGET integrated database retrieval system