KEGG   Citrus sinensis (Valencia orange): 102609492Help
Entry
102609492         CDS       T02983                                 

Definition
steroid 5-alpha-reductase DET2-like
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Castasterone biosynthesis, campesterol => castasterone
Brite
KEGG Orthology (KO) [BR:cit00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    102609492
Enzymes [BR:cit01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     102609492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 265 aa AA seqDB search
MASSSSSSSDQAFFNNCLLTLYLIAPPTFISLRFLQAPYGKHHRSGWGPTMSPPLAWFLM
ESPTLWLTLLIFPFGHNFRNPKSLILISPFLFHYFHRSCIYPLRLHRNKTQLTDFPVTVA
LMAFGFNLLNSFLQARWVSHYKDYDGESDGRLFWWRFLIGLVIFFCGMWVNIWSDKVLVG
LKKQGGGYKVPRGGWFELVSCPNYFGEILEWFGWAVMTWSWVGLGFFLYTCANLVPRALA
HHKWYLEKFGEDYPKHRKAVIPFLY
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatcatcatcatcatcatcagatcaagctttcttcaacaactgcctcctcaca
ctctacctcatagccccgccaacattcatatccctaagattcctccaagccccctacggc
aagcaccaccggtcggggtggggccccaccatgtcaccaccgttggcttggtttctgatg
gaaagccccaccctttggctcactctcttaatcttcccatttggtcataactttagaaac
ccaaaatctctcattttgatctccccttttctcttccattactttcaccgatcttgcatc
tacccacttcgccttcatcggaacaaaacccaattaaccgatttcccggtgaccgtagcc
ttaatggcatttgggtttaatctcttgaattctttcttgcaagctagatgggtttctcac
tacaaggattatgatggtgaatccgatgggcggttgttttggtggcggtttttgattggt
ttggtgattttcttctgcggaatgtgggtgaatatatggtctgataaagttctggtgggg
ctaaagaaacaaggtgggggttataaagtacccaggggtggctggttcgagcttgtaagt
tgcccaaattattttggtgagattttagagtggtttggttgggctgtgatgacatggtct
tgggtaggtttagggttttttctttacacgtgtgccaatttggtacccagggcacttgcg
catcataagtggtatctggagaagtttggtgaggattatcctaagcatagaaaagctgtt
atcccatttttgtattaa

DBGET integrated database retrieval system