KEGG   Citrus sinensis (Valencia orange): 102612446Help
Entry
102612446         CDS       T02983                                 

Definition
alpha-amylase-like
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cit00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102612446
Enzymes [BR:cit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102612446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 424 aa AA seqDB search
MSTLKSFCFLSFLLAIFLPFTSPALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHV
WLPPPSQSVAPQGYMPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAER
KDGRGIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQ
KELSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKP
DANQDGHRGALKDWVQAAGGAVAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQ
NAVTFIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGTPCIFYDHFFDWGLKEAISKLAA
VRNRNGINTASRVNILASDADVYIAAIGDRVIMKIGPKMDIGNLIPSDFKVAADGTDYAV
WEKN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgctaaagtcattctgcttcctctcttttcttcttgctatcttcctccctttc
acatctccagccttattgttccagggatttaactgggaatcaagtaacaaggcaggagga
tggtacaactctctgaagaactccattcctgatctttctaatgctggaattactcacgtc
tggcttcctccaccgtctcaatccgttgcaccccaaggatacatgccggggaggctatat
gaccttgacgcatcaaaatacggatctcaagctgatttgaagtctttaattcaggctttt
cgtcaaaagggaattaaatgccttgctgatatggtcataaatcaccgaactgcagagagg
aaagatggtagaggcatatattgcattttcgagggtggaacatcagatgaccgtctggac
tggggtccgtccttcatttgtcgtggcgacaaggagtattctgacggccaagggaatgat
gatacaggagaggacttccaaccagctcctgacattgaccatctcaacccgagggtgcaa
aaagagttatccgactggatgaattggctgaagactgaaattggatttgatggatggaga
ttcgattttgttaaaggatacgcccctagtatcaccaaagtttatatggaaaatacctcc
ccagattttgcagtcggggagaaatgggattccctttcttatgggcctgatggaaagcct
gatgctaatcaggatggacacaggggagcactcaaagattgggttcaagccgctggaggg
gctgtcgcagcttttgatttcaccacgaagggtatcctccaagctgctgtgcaaggggag
ctgtggagattaaaagactcgaacggcaagccgccaggattcattggaattttaccacaa
aatgctgtgacttttattgacaatcatgacacagggtccactcaacgtctgtggccattc
ccatcggataaagtcatgcttggatatgcttacatcctcacacatcccggcaccccttgc
atattttatgatcacttctttgactggggtctgaaggaggcgattagcaaattggctgct
gtcagaaataggaatgggatcaatacagcaagcagagttaatattttagcctcagatgcc
gatgtctacattgctgcaattggtgatagagtcattatgaagattggaccaaagatggat
attggaaatcttattccttctgacttcaaagtggctgccgatggaaccgactatgctgtc
tgggaaaaaaactga

DBGET integrated database retrieval system