KEGG   Citrus sinensis (Valencia orange): 102613952Help
Entry
102613952         CDS       T02983                                 

Definition
histone acetyltransferase type B catalytic subunit-like
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cit  Citrus sinensis (Valencia orange)
Brite
Enzymes [BR:cit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102613952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 466 aa AA seqDB search
MGQKKNPSADPVSEPKKRRRVGFSDVDEGVEANQCIKIYLVSSKEEVGVSDSFSIDPVDL
NSFFDEDGKIYGYQGLKITIWISSISFHAFADITFQSTSDRGKGITDLKSALQRIFAETL
VENKDDFLQTFSTEKDFTRSAVSSGEILQHKVSNGHVTHCNNNLKAAASDLEVVRMVVGN
MEAGHLYSRLIPLVLLLVDGSNPIDVTDPRWELYILIRKKMDQQGDIQHRLLGFTAIYRF
YHYPDSTRMRLSQILILPLYQRKGYGSFLTEVLSNVAVAENVHDFTVEEPLDSFQHVRTC
VDIQHLLAFEPIQHAINSAVSHLKQGKLSKKILAPRFVPPASTVEEVRKVLKINKKQFLQ
CWEILIYLRLDPVDKYMEDYTTIISNRVREDILGKDSGSTDKRIMDVPSSYDPEMSFVMF
KSQNVETSGVQMDENQPSQEEQLKQLVDERIKEIKLIAQKVSPLPV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggggcaaaagaaaaacccttctgccgatccagtctccgaacccaagaagcgaaggcga
gtcggattctcggatgtcgatgaaggagttgaggcaaaccaatgcattaaaatttatctg
gtgtctagcaaagaggaagtaggtgtttcagacagtttctcgattgatccagttgactta
aacagcttttttgatgaagatgggaagatttacggttaccaaggtttgaagataaccata
tggattagcagtatatcgtttcatgcatttgctgatattacatttcagagcacctctgat
aggggcaaaggaattacagatctaaaatctgctctacagaggatttttgctgagactctt
gttgagaataaagatgatttcctccaaacattttcaacagagaaagactttactagatct
gctgtatcaagtggggagatattgcaacacaaggtttccaatggacacgttactcattgt
aataataatctaaaagcagctgcttctgatttagaggttgttcgcatggtggtgggaaat
atggaagctggacacctctacagtcgtttaatacctcttgttcttcttcttgttgatgga
agcaaccctattgatgttactgatccaagatgggagttatatatcctgattcggaagaaa
atggatcagcaaggagatattcaacatagacttcttggttttacagcaatatatcgcttc
tatcattaccctgacagtacacgcatgcgactcagtcagattttgatattgcctctttac
cagcgcaagggctatggcagtttccttacagaggtgctcagcaatgttgcagtagctgaa
aatgtccacgacttcacagttgaagagccattagattccttccaacacgttcgcacttgt
gtcgacatacaacacctgcttgcttttgagccaatccagcatgcaattaactcagctgtt
tcgcatctgaagcaagggaaactatcaaaaaaaatccttgcccctcgatttgtgccacct
gccagtactgtagaggaagtcaggaaagtgttgaaaatcaacaagaaacagtttctccaa
tgttgggagattttaatatatcttcgccttgatcctgttgacaagtacatggaggattat
accacaatcatttcaaatcgtgtgagggaagatatcttaggaaaagattcaggcagtact
gacaagcgcataatggatgtacctagctcttatgatccggagatgtcttttgtcatgttc
aagtcacagaatgttgaaactagtggtgtccaaatggatgaaaatcaaccgagtcaagaa
gagcagctgaagcagttggttgatgaaaggatcaaagagatcaagttaattgcacaaaag
gtgtctccattaccggtctga

DBGET integrated database retrieval system