KEGG   Citrus sinensis (Valencia orange): 102614143Help
Entry
102614143         CDS       T02983                                 

Definition
uncharacterized LOC102614143
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cit00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102614143
Enzymes [BR:cit01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102614143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 464 aa AA seqDB search
MDGVKRWRWWAVFILGALIGSQFACGGGNDSTKANHEALVSRIAFGSCANQTAPQPIWDA
IIKFDPQVFIWMGDNIYGDIKRPSKMFGKERTTGPWKNVPRFVPTSQDEMNFKYHIIKNH
PAYSRLRHNLNTKIIGTWDDHDYGLNDAGKEFPAKVSNQRLLLDFLDEPLDSPRRMQAGI
YTSYTFGPVGRQIKIILLDTRYHRDPLSSDGTILGSTQWTWLEKELNGPSSAITIIVSSI
QVISNLSATTGPLFYMESWGRFPKERDRLFQLIADSKRNGVFFISGDVHFGEITRYDCDV
GYALYDITSSGLTQAVEKAVPAPFHFVVRFLAWWTPSTMRVIGKNCRHRSCTYGQPNFGA
IEIDWDATPVALKIEVRDTDGIPAIGVNISLSELQAQSVNSAATLRVGEHQKHCSLEVDL
PWIVRYRLTILFYFSVAVLLFALVGLNFAAAVVFRLFLRKCKLD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggacggcgtgaagaggtggcggtggtgggccgtctttatattgggagcgctgatagga
tcgcaatttgcatgcggcggtggtaatgattccacgaaagctaaccatgaagctctcgtc
tctcgtattgcctttggttcatgtgctaaccaaacggctcctcagcccatttgggatgcg
attataaagtttgatccccaagtgtttatttggatgggtgacaatatatatggagacatc
aaacgtccttctaagatgtttgggaaagaaaggaccactggaccctggaagaatgttcca
aggtttgtccctacctctcaagacgaaatgaactttaaataccacatcatcaagaatcat
cctgcctactctcgtttgcgccacaatcttaataccaagattattggtacatgggatgac
catgattatggattgaatgatgccggtaaagaatttcctgccaaagtttctaatcaaagg
cttctccttgatttcttagatgagcctcttgacagtccacgtcgcatgcaggctggcatc
tacacatcatatacatttggacctgtcggtagacaaatcaagataatcctgttagacact
agataccacagagaccctttgtctagtgatggaactattttggggagcacacaatggaca
tggttggaaaaagagttgaacggtccatcttccgccattaccataattgtatcatctatt
caggttatatcaaatctttcggctaccaccggccccttgttttatatggagtcttgggga
cgttttcctaaggagagggatcgcctttttcaattgattgctgatagtaagaggaatgga
gtcttctttattagcggggatgttcattttggtgaaattacacgttatgactgtgatgtt
ggatatgcactatacgatattacctcaagtgggctcacacaagctgttgagaaggcagtc
ccagcaccatttcatttcgtggtgagatttctagcttggtggacgccaagtacaatgaga
gttataggaaaaaattgcagacacagatcatgcacatatggccaaccaaattttggagcc
attgagatagattgggatgcaactccagtggccttgaaaattgaagttagggacacagat
ggaattcctgcaataggtgtaaatatttcattatcagaactacaagcacagagtgtaaac
tctgcagccaccttaagagtgggagaacatcagaagcactgctctcttgaagttgatctg
ccgtggattgtcagataccgcctgactattttattctatttttctgtggctgttttgctt
tttgctttggtaggactcaattttgcagctgcagtagtcttcaggctattcctccgcaaa
tgcaagcttgactaa

DBGET integrated database retrieval system