KEGG   Citrus sinensis (Valencia orange): 102619312Help
Entry
102619312         CDS       T02983                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cit00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102619312
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102619312
Enzymes [BR:cit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102619312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 945 aa AA seqDB search
MENGVKEEGENAASMPKVDPGQPPQLTWQRKLDSNVKVPTGFTLSFQEFRHLAHIGFRLY
RYSKQEEAKGKVPVFNVFRKHHITSDQGIPLGGIGAGSIGRSYRGEFQRFKLFHGICDDA
PVLANQFSVFVSRPNGEKFSSVLCPRSPGVPKKNTDSGIESWDWNLKGENCTYHALFPRA
WTVYDAGEPDPELRIVCRQISPFIPHNYKESSFPASVFTFTLSNSGQTSADVTLLFTWAN
SVAGDSGLSGHHFNSKTMTKDGVHGLTLHHRTANGRPPVTFAVAAEETADVHVSECPCFL
LSGNSKGITAKDMWNEIKKHGSFDHLDNDKTSPSEPGSSIGAAIAASLTIPSGSTRTVTF
SLAWDCPEVKFFEKVYHRRYTKFYGTLGDSAARIAHDAILEHAKWECEIEAWQRPILEDK
RFPEWYPITLFNELYYLNAGGTIWTDGSPPMQSLATIRERKFSLDTPRSDNKNIFCADDE
NDTANGILERMTSTLEKIHTPASSDTALGTRLLENGEENIGQFLYLEGAEYVMYNTYDVH
FYSSFALVMLFPKLELSIQRDFAAAVMMHDPGTMKIMSDGKWVTRKCLGAVPHDIGLDDP
WFEINSYNLFNSSRWKDLNSKFVLQVYRDFVATGDKNFARAVWPSVYIAMAYMEQFDKDG
DGMIENEGFPDQTYDAWSANGVSAYCGGLWVAALQAASALANDVGDHASASYFWVRYQKA
KAVYDSLWNGSYFNYDNSDGSSSTSIQADQLAGQWYARACGLLPIADEAKVKKALTKIYD
FNVLKVKGGMCGAMNGMQPDGRIDMSGLQAREIWPGVTYGLAASMIQEEMVDMAFQTAAG
VYEVAWSEDGLGYSFQTPESWNNNDEYRSLCYMRPLTIWAMQWALTKPKLSRQEIKHEIS
DRDSSYLEQHAAFSKVASLLKLPKEEASKGFLKVVYDFTIGRVLW
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atggagaacggtgtcaaagaagaaggagaaaatgcagcatccatgcccaaggttgacccg
gggcaacctccccagttgacatggcagcgaaaactggattctaatgtaaaagtcccaacg
ggattcactctaagttttcaagagtttaggcatttggcacatatagggtttagactatat
cgttatagcaagcaagaagaagcaaaaggaaaggtgccagttttcaatgttttcagaaag
catcatattaccagtgatcaaggcattcccttaggtggtattggtgcaggaagcattgga
agaagttacagaggcgagtttcaacgcttcaaactgttccacgggatttgtgatgatgcc
ccagttctggcaaatcaattttctgttttcgtttcacgcccaaatggagaaaagttttcc
agtgtattatgcccgaggagtccaggggtccccaaaaaaaatacagactctggcattgaa
tcttgggattggaatctgaagggtgaaaattgtacctatcatgctttgtttccgagggct
tggacagtctatgatgcaggggaacctgatccagaacttagaattgtttgtcgtcaaatt
tcaccttttattccccataattacaaagagagcagtttccctgcatcagtatttacattc
acgctatctaattcaggacaaacctctgcggatgtcacattgctttttacttgggctaat
tctgttgctggagactctggattatctggtcatcacttcaattcaaagacaatgacaaag
gacggagtgcatggattaactttacatcatagaacggcaaatggacgtcctccagtaact
tttgccgttgcagcagaggaaacagctgatgttcatgtctccgagtgcccttgcttcttg
ttatctggtaattccaaaggaatcacagctaaagacatgtggaatgaaataaaaaagcac
ggatcatttgaccaccttgacaatgataaaacgtcaccttcggaaccaggatcatccatt
ggagcagccatagcagcctctttaactattccttctggatctacccgtactgtcacattt
tcattggcgtgggactgtccagaagtcaaattttttgaaaaggtgtaccacaggcgttat
acgaaattttatggcactctaggggattcagcagctagaattgcgcatgatgccatcctt
gagcatgctaaatgggaatgcgagatagaagcatggcaaagaccaattcttgaagacaaa
aggtttcctgaatggtacccaatcactctttttaatgagctttattatctcaatgctgga
ggaactatttggacagatggctcacctccaatgcaaagtttggcaaccattagggaaaga
aaattttctcttgatactccaaggtcagataataagaatattttttgtgcggacgatgaa
aatgacactgctaatggaatccttgaaaggatgacatctacgcttgagaaaattcatact
ccagcatcgtctgatactgctcttggaacccgtttacttgaaaatggagaagaaaatatt
ggtcagttcctgtaccttgaaggggctgaatacgtcatgtataatacatacgatgtccat
ttctattcatcttttgcactggtcatgctattccccaaactagaacttagcattcagaga
gactttgcagcagcagtaatgatgcatgatcctggtacaatgaaaattatgagtgatgga
aagtgggttactcgaaaatgtctcggtgctgttccccatgatattgggcttgatgaccca
tggtttgaaataaatagttataacctgttcaattcatctcggtggaaagacttgaattct
aaatttgttctccaagtttacagggattttgtagccactggtgataaaaattttgcaagg
gctgtttggccctcggtttatattgctatggcttatatggaacagtttgataaggatggg
gatggaatgattgagaatgaagggtttcctgatcagacttatgatgcatggtcagctaac
ggggtcagtgcttattgcggtgggctgtgggtggctgcccttcaggctgcctcagccttg
gcaaatgacgttggtgaccatgcatctgccagttacttctgggttagatatcagaaagca
aaagctgtatatgacagtctatggaatggttcctacttcaattatgacaacagtgatggt
agttcaagcacatccattcaggcagatcaattggctgggcaatggtatgcaagagcatgc
ggtcttttgccaattgctgatgaagctaaagtgaagaaagcacttacgaaaatttacgac
ttcaatgtcttaaaggtgaaaggaggaatgtgtggggcaatgaacggtatgcaacctgat
ggaagaattgatatgtctggcttgcaggcaagagaaatatggcctggagttacatacggc
cttgctgcttctatgattcaagaggagatggtggatatggcatttcagacggccgctggt
gtctatgaagtagcttggtccgaagatggtcttggatactcttttcagactccagaaagt
tggaacaacaatgacgagtacagatctctctgttatatgcggccattgaccatatgggca
atgcagtgggctttgacaaagccaaagctgagcaggcaagagataaaacatgagataagt
gatcgggattcttcatacttggagcaacatgcagcattttcaaaagtggcttctctgtta
aagttgccgaaggaggaagcttccaaaggcttcctaaaggttgtttatgacttcacaatc
ggaagagttctttggtaa

DBGET integrated database retrieval system