KEGG   Citrus sinensis (Valencia orange): 102620271Help
Entry
102620271         CDS       T02983                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cit  Citrus sinensis (Valencia orange)
Brite
Enzymes [BR:cit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102620271
Transfer RNA biogenesis [BR:cit03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    102620271
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 564 aa AA seqDB search
MATAVLPQDTKKLPRPGRGGFQAHGLTEEEARVRAIAEIVNSMVELSRKNETVDLNAIKS
AACRKYGLARAPKLVEMIAALPENDREALLPKLRAKPVRTASGIAVVAIMSKPHRCPHIA
TTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVD
KVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVTYSEHGATKCIGMTIETR
PDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVA
HMMPDLPNVGVERDLESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPE
QLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRT
REAGIQDIHHQIKPEEVELVRRDYVANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCP
ELMGKCSIVRELHVYGTAVPVHGREADKLQHQGYGTLLMEEAERIALREHRSRKMAVISG
VGTRHYYRKLGYELEGPYMVKYLE
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgtgctaccacaagacaccaaaaagctcccccggcccgggcggggcgga
tttcaggcccacggccttaccgaagaagaggctcgagtccgggccatcgccgaaatcgtc
aactcaatggttgaactatcacgcaaaaacgaaacggtcgacctaaacgcaataaaatcc
gccgcgtgccgcaagtacggtcttgcacgcgcccctaaattagtagagatgatcgccgcg
ctacccgagaatgaccgcgaagccttgctgcccaagcttcgagccaagcccgtcagaacg
gcttccggtattgctgtcgtggccattatgtcaaaaccacacagatgcccccatatcgcg
acgactggaaacatttgcgtgtactgtccgggtgggccagactctgattttgagtacagt
acgcagagttacactggatacgagcctactagcatgcgcgctattagagccagatacaat
ccatatgtccaggcaagaagcaggattgatcagctaaaacgtttgggtcatagcgtagac
aaggttgagttcatcttaatgggtggtaccttcatgtctctgccagcagattaccgtgat
tactttataaggaatcttcatgatgctttatctggacatacttctgccaatgttgaagag
gcagtcacttattctgagcatggtgctacaaaatgtattggcatgacaattgaaacgagg
ccagattattgccttggacctcatttgcgccaaatgctttcttatggttgtacacgattg
gagataggagttcaaagcacatatgaggatgttgctcgtgacacaaatagagggcatacg
gtagctgctgtggctgattgtttttgcctggcaaaggatgctggtttcaaggttgttgct
catatgatgcctgatcttccaaatgttggagtcgagagggacttggaaagttttcgggag
ttctttgagagcccattatttagagctgatgggcttaaaatttatcctacgcttgtgatt
cgtgggactgggctttatgagctctggaaaactggtaggtatagaaattacccacctgag
caacttgtggacattgtcgccaggattctagccatggtacccccttggactcgtgtttat
agagttcagcgtgatattcccatgcctttggttacttccggggttgagaaagggaacctt
cgggagctagctttagctcggatggatgacttgggcttgaaatgccgtgatgttcggaca
cgtgaagctggaattcaggacatccatcatcaaataaagccagaagaagtagagcttgtc
cgtcgtgattatgtggcaaatgaaggttgggaaacatttctttcgtacgaagacacacgc
caggatattcttgttggcttgttgcgcttgaggaagtgtgggcggaatgttacttgtcca
gagctcatgggcaagtgttctattgttcgtgaactccatgtgtatggaactgctgttcct
gtgcacggtcgggaagctgacaagctgcaacaccagggttacggtacactcttaatggaa
gaggcagagcggattgcacttagagagcacagatcaagaaagatggccgttatttcaggt
gtaggaactcgacattattatagaaaattgggatacgaacttgaaggtccttacatggtg
aaatatcttgagtga

DBGET integrated database retrieval system