KEGG   Citrus sinensis (Valencia orange): 102620360Help
Entry
102620360         CDS       T02983                                 

Definition
probable ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cit00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    102620360
Enzymes [BR:cit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     102620360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 377 aa AA seqDB search
MKGISLSPSNNCQLKFQNILAKQLNKPINTTPFHFTTTNRQFPTHVIKCQCQRRDQNLVP
KNPINTPPPLVVVGSANFDIYVEIDRLPKVGETVSAKTSQTLAGGKGANQAACGAKLSHP
TYFVGQVGEDASGKLITDALSGCGVRLDYVNVVKDGGVPTGHAVVMLQSDGQNSIIIVGG
ANMSCWPEKFGDEDLEVVKKAGIVLLQREIPDSVNIQVAKAARSAGVPVIFDVGGMDAPM
PQELLNFIDILSPNESELGRLTGMPTDSYEQISEAVVKCHKMGVKQVLVKLGAKGSALFV
EGEKPIKQSIIPAARVIDTTGAGDTFTASFAVGFVEGKSREECLRFAAAAASLCVQVKGA
IPSLPDRKSVLNLLQYA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaatatcgctttcaccatcaaacaattgtcaactcaaattccaaaacatcctc
gcaaaacaactcaacaaaccgatcaacacaaccccatttcacttcaccaccacaaatcgc
caattccccacacatgttattaaatgccaatgtcagcgaagagaccaaaacctagtaccc
aaaaaccccattaacacgccaccaccactggtagtagttggctcagccaattttgatatc
tatgtggaaatcgacaggcttcctaaagtaggcgagacagtttcagccaagactagccag
actcttgctgggggcaagggtgccaatcaggctgcttgtggggcgaaactctcccatcca
acttactttgtgggtcaagtgggtgaagatgcaagtgggaaattgatcactgatgctttg
agtggatgtggggtgagattggattatgtgaatgttgttaaagatggtggtgtccctact
ggacacgctgtggtgatgctgcagtctgatgggcagaactctattatcattgttggtggg
gctaatatgagttgttggcctgagaagtttggtgatgaggatttggaggttgtgaagaag
gctgggattgttttgcttcagagggagattcctgattctgtcaacattcaagttgcaaag
gctgcaagaagtgcaggtgttccagtcatttttgatgtagggggaatggacgctccaatg
cctcaagaactgttgaattttattgatatcttgagccccaatgaatccgaacttggtcgt
ttgactggaatgccaactgacagttatgaacagattagtgaagctgtggtgaagtgccat
aaaatgggtgttaagcaagtcctagtgaaacttggggccaagggatcggctctatttgta
gaaggggagaaaccaattaaacaatcaattataccagctgcaagagtcatagatacaact
ggagctggtgacactttcactgcctcttttgccgtgggttttgttgagggcaagtcaaga
gaggaatgtttgagatttgctgctgcagctgcttctctttgtgtccaagtgaagggagcc
attcctagtttgcctgataggaaatctgttttgaatcttcttcagtatgcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system