KEGG   Citrus sinensis (Valencia orange): 102621076Help
Entry
102621076         CDS       T02983                                 

Definition
formamidopyrimidine-DNA glycosylase-like
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cit00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    102621076
Enzymes [BR:cit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     102621076
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     102621076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 408 aa AA seqDB search
MPELPEVEAARRAIEEHCIGKKIVKSIIADDNKVIDGVSASDFEASVLGKTILSAHRKGK
NLWLRLDSPPFPSFQFGMTGAIYIKGVAVTQYKRSAVKDTDEWPSKYSKFFVELDDGLEL
SFTDKRRFAKVRLLNDPTSVPPISELGPDALLEPMTVDEFTDSLSKKKITIKALLLDQSY
ISGIGNWIADEVLYQAKIHPLQTAASLSKKSCATLLKCIKEVIEKALEVGADSSQFPSNW
IFHSREKKPGKAFVDGKKIDFITAGGRTTAYVPELQKLNGVQAAKAVGKPRKQVPKGEDS
KDDDKYNSGDESESDGEEIAENVKSKKRQKLGGQVKQPSSRKRKSKESDTEDDDGGNDDD
GSGSDDNAEEAPKTKSGKVTKNKQAKAVTTSKEKVISQKVKPSKKKAK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctaccagaggtggaggcggcgagaagggccatagaggagcattgcatcggt
aagaaaatcgtgaaatcgatcatcgccgacgacaacaaggtgatcgacggagtttctgcg
tcggatttcgaggcatcggttttgggcaaaaccattttatctgctcataggaagggcaaa
aacttgtggctccgcctcgattcccctcctttcccttcctttcagttcggaatgaccggt
gctatttacattaagggggttgctgttacacaatataagaggtcagctgtaaaggacact
gatgaatggccttccaaatattcaaagttctttgttgaactagatgatggtttggaactg
tctttcactgacaagaggcgatttgctaaagttcgcctgctcaatgatccaacttctgta
ccacctatatctgaacttggtcctgatgcattgctggagcccatgacggttgatgaattt
actgattcattaagcaaaaagaaaattacaattaaggctctattacttgatcagagttat
atttcaggaattggcaattggattgcagatgaagttttataccaagccaaaattcatcca
ttgcaaactgctgctagcttatccaaaaaaagctgtgcaactttactcaagtgcatcaaa
gaggtgattgaaaaagctcttgaagttggggcagatagtagtcaatttccaagtaattgg
atttttcattcccgtgaaaagaagcctggcaaggcttttgttgatgggaagaaaatcgat
tttattactgctggtggcaggacaacagcctatgtaccagagctgcaaaaactaaatgga
gtccaagctgcgaaagcagtgggtaaaccgaggaagcaagttcccaaaggagaagatagc
aaggatgatgacaaatacaatagcggtgatgagtcagaaagtgatggagaggaaattgct
gaaaatgtcaaatcaaagaaaaggcagaagcttggaggtcaagttaaacagccttcgtcg
aggaaaagaaaatctaaagagagtgacaccgaagacgatgacggcggtaatgatgatgat
ggtagtggcagtgatgacaatgctgaggaagcaccgaaaacaaagtcaggaaaggttact
aaaaataaacaagcaaaggcagtgacgacgtcaaaggaaaaggttatcagtcaaaaagtt
aagccgtcaaagaagaaagcaaagtag

DBGET integrated database retrieval system