KEGG   Citrus sinensis (Valencia orange): 102621610Help
Entry
102621610         CDS       T02983                                 

Definition
josephin-like protein-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
cit  Citrus sinensis (Valencia orange)
Brite
Enzymes [BR:cit01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102621610
Peptidases [BR:cit01002]
 Cysteine Peptidases
  Family C86
   102621610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 382 aa AA seqDB search
MASENCKIYHERQKLQFCLLHSLNNLFQQEGAFTRASLNEIAEKLVLDYPNKQTWTPLSV
VFKPHHNALTGNYDINVLIAALEGRGKSVVWHDRRNEASAIDLDGGENCLMGIVINVPVT
RYAGLWKSRHWVALRKIDGVWYNLDSDFHAPQCFKDSKEVREFLDYIIGLGGEVLLVKND
KENFAPLFSTYCPSFCPLLELSLLYLSVYLNRSLQKMSAKESSQVSSKAGISIAQKQNSI
NRVVGTVKATESCETKWRNQVSCIPSTKKENKINKRNCINKVAAKKKRSGGGCGIRLPKR
SEVSPVRFFKHLSRRMARGLCFAYFKKRHSATVSATVSSSGRSKPSVIPVDSHRSEAIED
CIEFINSSSSLPRSNSVSTNAS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgaaaattgcaaaatttatcacgagaggcaaaaattacagttctgcctcttg
cactcactcaataatctctttcagcaagaaggtgcatttacgcgagcaagcttgaatgaa
attgctgagaaactcgtgcttgattatccaaataagcaaacgtggactcccttatctgtg
gtctttaagcctcaccataatgcattgactggaaattacgatataaatgtgcttattgct
gctcttgaaggaagaggaaagagtgtcgtgtggcatgatcgtcgaaatgaggcatcggca
attgatcttgatggcggggaaaattgtttgatgggtattgtgattaatgttccagttacg
cggtatgctgggctttggaagagtagacattgggttgcattgcgaaagattgacggggtt
tggtataatttggatagtgattttcatgctcctcagtgttttaaagatagcaaagaagtt
agggagttcttagattatattattggtcttggtggggaggttttgcttgttaagaatgat
aaggagaacttcgcacccctattttccacttactgcccttcattttgccctcttctggag
ctctctcttctctatctctctgtctatcttaatcggtctttgcagaagatgtcagcaaaa
gagagtagccaagtgagtagcaaagcaggcataagcatagcccagaagcagaactctatt
aacagagttgtcgggaccgtgaaagccacggagtcttgcgaaacaaaatggagaaaccaa
gtgagctgcattcccagcactaaaaaggagaacaaaatcaacaaaagaaactgtattaac
aaagttgcggcgaagaagaagaggtctggtgggggctgtggaatcaggctaccaaaaaga
tcagaggtctcaccagttagatttttcaagcatcttagcagaaggatggcaagaggtctg
tgctttgcatactttaagaagagacattcagctacagtttcagccactgtctcttcatca
ggaagatcaaagccgtctgtgattcctgttgattctcatagaagtgaagccattgaagat
tgcatcgagttcatcaactcttcttcttctctaccaagatcaaactctgtttctacaaat
gcttcttaa

DBGET integrated database retrieval system