KEGG   Citrus sinensis (Valencia orange): 102621631Help
Entry
102621631         CDS       T02983                                 

Definition
(RefSeq) protoporphyrinogen oxidase, chloroplastic/mitochondrial
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00860  Porphyrin and chlorophyll metabolism
cit01100  Metabolic pathways
cit01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cit00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    102621631
Enzymes [BR:cit01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     102621631
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     102621631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 HI0933_like Thi4 FAD_oxidored Pyr_redox_2 AlaDh_PNT_C FAD_binding_3 IlvN GIDA FMO-like Pyr_redox Pyr_redox_3 3HCDH_N NAD_binding_9 MCRA
Motif
Other DBs
NCBI-GeneID: 102621631
NCBI-ProteinID: XP_006470020
Position
2
AA seq 509 aa AA seqDB search
MASAPGEDNQRSAKRVAVVGAGVSGLAAAYKLKSNGVNVMVFEADERAGGKLRSISKDGL
IWDEGANTMTESEMEVKGLLDDLGIREKQQFPISQYKRYVVRNGVPFLIPTNPIALITSN
FLSAQSKFQIILEPFLWKKSDSAKVSAEDAKESVGGFFQRHFGREVVDFLIDPFVAGTSA
ADPESLVMRHSFPELWNLEKRYGSVIAGAIKSKFSARKEKSAEAKGSSEKKHRQRGSFSF
LGGMQTLTDALCKALGKDEVCLKSKVLSLSYSHDGKSALENWSLSSSNQDKQSQGLSFDA
VIMTASLCNVKEMKITKGGNLFPLDFLPEVIYMPLSVFITAFKKENVGKPLQGFGVLVPS
KEQQNGLKTLGTLFSSMMFPDRAPKDLFLYTTFVGGSRNKELAKASTDELKQIVTSDLRQ
LLGVEGEPTFVNHFFWSKAFPLYGRDYDSVLEAIEKMEKNLPGFFYAGNHKGGLSVGKSI
ASGCKAAELVISYLENSSDDKMLKEGSSK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagctcccggagaagataaccagcgctctgccaaacgagtggctgttgttggt
gctggtgttagcgggcttgcagctgcttacaagttaaaatcaaatggtgtaaatgtcatg
gtatttgaagctgatgaaagagctggagggaagttgaggagtatctcaaaagatggtcta
atttgggatgagggagcaaacacaatgactgagagcgagatggaagtcaaaggtttgctc
gatgatcttggaattcgagaaaaacaacaatttccaatttcacagtacaaacggtatgtt
gtgagaaatggggtgccatttctgatccccaccaatcccattgctcttataacgagtaac
tttctttctgctcaatcaaagtttcagatcattcttgagccctttttgtggaagaaaagt
gactctgcgaaagtgtctgctgaggatgcaaaagaaagtgtgggtgggttcttccagcgt
cattttgggagagaggttgttgatttcctcattgacccttttgttgcgggcacgagtgct
gcagatcctgaatctcttgttatgcgccattcattcccagagctttggaatctagagaaa
aggtatggttcagtcatagctggagcaattaaatcaaagttttctgccagaaaagaaaaa
agcgcagaagcaaagggttcttcagaaaagaaacatcgtcagcggggttcattttctttt
ttgggtggaatgcagaccctcactgatgcattgtgcaaagcacttggcaaggatgaggtt
tgtctgaaatcaaaggttctgtcattatcttatagtcatgatgggaaatcagcattagag
aattggtcactctctagttctaaccaagacaagcaatcacaaggcctatcttttgatgct
gtaatcatgacggcttcactctgcaatgttaaagaaatgaagattacgaagggaggaaat
ctttttccactggactttcttcctgaggtgatttacatgccgctatcagtcttcatcacc
gcctttaagaaagagaatgtcgggaagcctcttcaaggatttggagttcttgtaccttct
aaggagcagcaaaatggtttaaaaactcttggtacactattttcctctatgatgtttcct
gatcgagcacctaaagatttgtttctctatacaacctttgttggaggaagtcgcaacaag
gaattggcaaaagcttcaacggatgaattgaagcagattgttacttctgacctgaggcag
ttgctgggagtggaaggggaacccacgtttgtgaatcatttcttctggagtaaggcgttt
cccttgtatgggcgtgactatgactccgttttagaagcaattgaaaagatggagaaaaat
cttcctggattcttttatgcaggtaaccacaaaggtggattgtccgtgggaaaatcaata
gcctccgggtgcaaagctgctgagcttgtaatttcctatctggaaaattcttcagatgac
aagatgctcaaagaaggatcatcaaagtag

DBGET integrated database retrieval system