KEGG   Citrus sinensis (Valencia orange): 102621631Help
Entry
102621631         CDS       T02983                                 

Definition
protoporphyrinogen oxidase, chloroplastic/mitochondrial-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cit00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    102621631
Enzymes [BR:cit01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     102621631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 509 aa AA seqDB search
MASAPGEDNQRSAKRVAVVGAGVSGLAAAYKLKSNGVNVMVFEADERAGGKLRSISKDGL
IWDEGANTMTESEMEVKGLLDDLGIREKQQFPISQYKRYVVRNGVPFLIPTNPIALITSN
FLSAQSKFQIILEPFLWKKSDSAKVSAEDAKESVGGFFQRHFGREVVDFLIDPFVAGTSA
ADPESLVMRHSFPELWNLEKRYGSVIAGAIKSKFSARKEKSAEAKGSSEKKHRQRGSFSF
LGGMQTLTDALCKALGKDEVCLKSKVLSLSYSHDGKSALENWSLSSSNQDKQSQGLSFDA
VIMTASLCNVKEMKITKGGNLFPLDFLPEVIYMPLSVFITAFKKENVGKPLQGFGVLVPS
KEQQNGLKTLGTLFSSMMFPDRAPKDLFLYTTFVGGSRNKELAKASTDELKQIVTSDLRQ
LLGVEGEPTFVNHFFWSKAFPLYGRDYDSVLEAIEKMEKNLPGFFYAGNHKGGLSVGKSI
ASGCKAAELVISYLENSSDDKMLKEGSSK
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagctcccggagaagataaccagcgctctgccaaacgagtggctgttgttggt
gctggtgttagcgggcttgcagctgcttacaagttaaaatcaaatggtgtaaatgtcatg
gtatttgaagctgatgaaagagctggagggaagttgaggagtatctcaaaagatggtcta
atttgggatgagggagcaaacacaatgactgagagcgagatggaagtcaaaggtttgctc
gatgatcttggaattcgagaaaaacaacaatttccaatttcacagtacaaacggtatgtt
gtgagaaatggggtgccatttctgatccccaccaatcccattgctcttataacgagtaac
tttctttctgctcaatcaaagtttcagatcattcttgagccctttttgtggaagaaaagt
gactctgcgaaagtgtctgctgaggatgcaaaagaaagtgtgggtgggttcttccagcgt
cattttgggagagaggttgttgatttcctcattgacccttttgttgcgggcacgagtgct
gcagatcctgaatctcttgttatgcgccattcattcccagagctttggaatctagagaaa
aggtatggttcagtcatagctggagcaattaaatcaaagttttctgccagaaaagaaaaa
agcgcagaagcaaagggttcttcagaaaagaaacatcgtcagcggggttcattttctttt
ttgggtggaatgcagaccctcactgatgcattgtgcaaagcacttggcaaggatgaggtt
tgtctgaaatcaaaggttctgtcattatcttatagtcatgatgggaaatcagcattagag
aattggtcactctctagttctaaccaagacaagcaatcacaaggcctatcttttgatgct
gtaatcatgacggcttcactctgcaatgttaaagaaatgaagattacgaagggaggaaat
ctttttccactggactttcttcctgaggtgatttacatgccgctatcagtcttcatcacc
gcctttaagaaagagaatgtcgggaagcctcttcaaggatttggagttcttgtaccttct
aaggagcagcaaaatggtttaaaaactcttggtacactattttcctctatgatgtttcct
gatcgagcacctaaagatttgtttctctatacaacctttgttggaggaagtcgcaacaag
gaattggcaaaagcttcaacggatgaattgaagcagattgttacttctgacctgaggcag
ttgctgggagtggaaggggaacccacgtttgtgaatcatttcttctggagtaaggcgttt
cccttgtatgggcgtgactatgactccgttttagaagcaattgaaaagatggagaaaaat
cttcctggattcttttatgcaggtaaccacaaaggtggattgtccgtgggaaaatcaata
gcctccgggtgcaaagctgctgagcttgtaatttcctatctggaaaattcttcagatgac
aagatgctcaaagaaggatcatcaaagtag

DBGET integrated database retrieval system