KEGG   Citrus sinensis (Valencia orange): 102621775Help
Entry
102621775         CDS       T02983                                 

Gene name
Cs-bFruct1
Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00052  Galactose metabolism
cit00500  Starch and sucrose metabolism
cit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cit00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    102621775 (Cs-bFruct1)
   00500 Starch and sucrose metabolism
    102621775 (Cs-bFruct1)
Enzymes [BR:cit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     102621775 (Cs-bFruct1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 102621775
NCBI-ProteinID: NP_001275813
UniProt: Q05JI2
Position
5
AA seq 687 aa AA seqDB search
MADSNVSYNPLPDGERPRPTRRRSIVLVLSGLLVVGFLVALLSDNGSIAPTNVIDNDNNN
VNDNAQNGLNDVSSSSKDPERLRPFTSASSAGVSEKSNRRFGARTASYPWTNNMLSWQRT
AFHFQPQKNWMNDPNGPVFYKGWYHLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAM
VADQWYDIMGVWTGSATILPDGKLMMLYTGSTNESVQVQNLAYPADPSDPLLIKWVKYPG
NPVLVPPPGIGAKDFRDPTTAWLTSEGKWRIAIGSRINRTGITFVYDTKDFINYELLRGV
LHGVPNTGMWECVDFYPVSTTGEHGLDTSHNGPGVKHVVKASMDDDRHDYYAIGTYHEKN
VTWVPDNPEIDVGIGIRYDYGLFYASKTFYDQNKKRRVLWGWIGESDSEIADVKKGWASL
QGIPRTVALDTKTGSNLLQWPVEEVDSLRLTSKEFKKIELKPGSVMPLDVGSATQLDIVA
EFELDKAALEKTAESNVEFSCSSSEGSAERGALGPFGLLVLADDSLSEQTPVYFYIAKGK
DGSLKTYFCTDQSRSSEANDVNKSKYGSFVPVLEGEKFSMRVLVDHSIVEGFAQGGRTTI
TSRVYPTKAIYGAARVFLFNNATGASVTSSLKAWQMNSAFIRPYPDDDDERHSGTEPTYE
VRGSKTKYLGNLLTSSLLFLNARNNFL
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggcagattctaatgtatcctacaatcctctcccggacggggaacgtccgcggccaact
cgccggagatccatcgtcttggttctatccggtttgttggtcgttggttttttagttgca
ttattatccgataatggatctatagcccctactaacgttattgataatgacaataataat
gttaatgataatgcacaaaatgggcttaatgatgtgtcgtcgtcgtcgaaagaccccgag
agactccggccgtttacgagtgcctcgtcggccggggtgtctgagaagtcgaaccggcgg
tttggtgcaaggacggcgtcgtatccctggaccaataatatgctgtcgtggcaaaggacg
gccttccactttcaaccccaaaagaattggatgaatgatcctaatggtccagtgttttac
aaaggatggtaccatttgttctaccagtacaacccaaatggcgcaatatggggtgacata
gtgtgggggcatgctgtgtcaaaggacctgatccattggtatcacctcccgttggccatg
gttgccgatcaatggtatgatattatgggtgtctggaccggctctgctacaatcctacct
gatggaaaacttatgatgttgtacactggatccaccaacgagtctgtgcaggtccaaaat
ctcgcatatcctgccgacccatctgatcctctactcatcaaatgggtcaaataccccgga
aaccctgttctagtcccgccacctggcattggtgccaaggacttccgtgatccaacaaca
gcttggttgacatccgaaggaaagtggcggattgcaattgggtctaggattaacagaact
ggcataactttcgtttatgatactaaggacttcataaattatgaactgttgcgtggggtg
ttacatggcgtccctaacactggcatgtgggagtgcgtggacttttatccagtgtcaaca
actggagagcatggcttggatacatcacataatggcccgggggtgaagcatgttgtcaag
gcaagcatggatgatgataggcatgattactatgcaattggcacttatcatgagaagaat
gtgacatgggtgccagataatcccgagatcgatgttggcattggaattaggtatgattac
gggttgttctatgcgtccaagacgttctatgatcagaacaagaagaggagagtgttgtgg
ggttggattggagaatctgacagtgaaattgcggatgtgaagaaaggatgggcgtcgctt
cagggcattccaaggacagtggcgcttgatacaaaaactggtagtaatctccttcaatgg
ccagtggaggaagtagacagtttgcgattgaccagcaaagaatttaaaaagattgagctc
aagccagggtcagtgatgccgcttgatgttggctcagctactcagctggacatagtggcc
gagtttgagctagacaaggcggctttagagaaaacagcggagtccaatgtggagtttagc
tgcagttccagcgaaggatctgctgaacgcggagcattaggcccctttggccttctggtt
cttgcagatgacagcctatccgagcaaactccagtctatttctacattgcgaaaggaaag
gatggaagtctcaagacttacttctgcactgatcaatcaagatcttctgaggcaaatgat
gtcaataaatcaaaatatggtagctttgttccagtactggaaggcgagaaattctcaatg
agagtattggtggatcattcgatagtcgaaggctttgctcaaggtgggagaacaactatt
acttcgagggtttatccaacaaaggcaatttatggagccgctcgggtatttttgttcaac
aatgctaccggcgccagcgttacaagctcactcaaagcatggcaaatgaattctgcattc
atccgtccatacccggatgatgatgatgaacggcactcggggacggaaccaacatatgaa
gttagagggagcaaaactaaatatctcggcaatttgttgacgagttctttgttatttcta
aacgcccgcaacaattttctatag

DBGET integrated database retrieval system