KEGG   Citrus sinensis (Valencia orange): 102625213Help
Entry
102625213         CDS       T02983                                 

Definition
histone acetyltransferase HAC1-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
cit  Citrus sinensis (Valencia orange)
Brite
Enzymes [BR:cit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102625213
Transcription factors [BR:cit03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    102625213
Mitochondrial biogenesis [BR:cit03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102625213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 1768 aa AA seqDB search
MNVQAHISAGQVPNQGGLPQQNGNALQPNQMQNLVGGVSTTAAIAAGGSGGGVTPQRNMF
NADPDLLRARGFMRDRIFGMLLHRQTQTIDETQRTKFKDISKRLEEGLFKAASTKEDYMN
MDTLEARLSYLIKGRPGNNHNQRHQQLVNSSSSIGTMIPTPGMSHCGNSSLMVTSSVDSS
MIAASGCNTIAPTTVNSGSLLSTGGIQSNSYNRSDGTLSNGYQQSPANFSVGSSGNMPSM
GVQRIASQMIPTPGFNNNSNQTNSSSNQSYMNLESNNGGGFSTVESAMVSLPQQQKQHVG
GQNSRILHNLGSHMGSGMRSGLQHKSYGFSNGALNGGLGMIGNNLLINEPGTSEGYLTGT
QYANSPKPLQHHFDHQRPMVQGDGYGASNADSYGTGNFYGAVTPVGSMTNTPNMNSGSLQ
SMPIAKTSATLMGNQSNFHGATQGTQVKAPSIDQSEKMNFHSSLSSRDNLLQSQQQQQFP
QQPHHVQQQQFVQHQRQQKPQSQQQHLLNNDGYGHSQMMSDMISQVKREPGMEQHNEVMH
SQGPEQFQLPESQNQFQLTSGEDRSRGAQHLSVSSGQHDICSSLTQMSQPMQQMLHSHQL
VADSHNGFNCFSIGGQSESVPQGQWHSQSQEKTHMAGNMSHEQHVQEDFRQRIAAQGEAQ
RNNLSSEVSVISQSVGPRVMAEHPISRGASCRLTNGNRDRQFRNQQRWLLFLRHARRCAA
PEGKCQDVNCITVQKLWRHMDNCTSSQCPYPRCHHSKILIHHHKHCRDPSCPVCVPVKNY
LQQQKERARPKTDSCLPSSVSESCKSYDTGDASGGMISKTPAVVETSEDIQPSLKRMKIE
PSSQSLAPENKSSTVSASAIAETQVSQDVLQQDYQNVKIGMPVKSEFMEVKMEVPVSSGQ
GSPHNNEMKDDVVESNNQRPDGERIVYDEPTASAKQENNKVEKESDVAKQESLTQPAENA
AATKSGKPKIKGVSLTELFTPEQVREHICGLRQWVGQSKAKAEKNQAMEHAMSENSCQLC
AVEKLTFEPPPIYCSPCGTRIKRNAMYYTMGAGDTRHYFCIKCYNEARGDTIVVDGTTIA
KARLEKKKNDEETEEWWVQCDKCEAWQHQICALFNGRRNDGGQAEYTCPNCYITEVERGE
RKPLPQSAVLGAKDLPRTILSDHIEHRLFRRLKQERQERARIQGKSYDEVPGAEALVIRV
VSSVDKKLEVKQRFLEIFQEENYPTEFPYKSKVVLLFQKIEGVEVCLFGMYVQEFGSECQ
FPNQRRVYLSYLDSVKYFRPEIKAVTGEALRTFVYHEILIGYLEYCKLRGFTSCYIWACP
PLKGEDYILYCHPEIQKTPKSDKLREWYLAMLRKAARENIVVDLTNLYDHFFVSTGECRA
KVTAARLPYFDGDYWPGAAEDLIYQIRQDEDGKKQNKGITKKTITKRALKASGQTDLSGN
ASKDLLLMHKLGETICPMKEDFIMVHLQHACNHCCILMVSGSRHVCEQCTKLNKNFQLCD
KCFEAEKKREDRERHPVNSREVHILEEVPVTDVPADTKDKDEILESEFFDTRQAFLSLCQ
GNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNICHLDIETGQGWRCEVCPDYDVCN
ACYQKDGGIDHPHKLTNHPSTADRDAQNKEARQLRVLQLRKMLDLLVHASQCRSPHCQYP
NCRKVKGLFRHGIQCKTRASGGCVLCKKMWYLLQLHARACKESECHVPRCRDLKEHLRRL
QQQSDTRRRQAVMEMMRQRAAEVAGNAG
NT seq 5307 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtacaggcacatatatcagcggggcaggttcctaatcaaggaggactgccccag
cagaatggaaacgcgctgcaacctaatcaaatgcaaaatttagttggtggtgtttctacc
actgctgctattgctgctggtggtagtggtggtggggttactccacagcgtaatatgttc
aatgccgaccctgacctgctcagagcacgaggttttatgcgcgacagaatctttggaatg
ttattgcaccgccagacgcaaacaattgatgaaacgcagagaacaaagttcaaagatatt
tcaaaacgcttagaggagggtctttttaaagctgcttctacaaaggaggattatatgaat
atggataccttagaggctcgtttgagttatctgatcaagggcagacctgggaataatcat
aatcaaagacatcagcagcttgtaaattcttcttcttccattggtacaatgatcccaaca
cctggcatgtcacactgtgggaattcatccctaatggtcacatcgtctgtagatagttca
atgatagctgctagtggatgtaacactatagcacctacaaccgtcaattctgggagcctg
ttgtcaactggtggcatacagagtaattcctataatagatctgatggaaccctttctaat
ggatatcaacaatcacctgccaatttttccgttggttctagtggaaacatgccatcaatg
ggcgtccaaagaattgcaagtcaaatgattcctacccctggatttaacaataatagcaac
cagaccaacagcagcagtaatcagtcctacatgaatctggagtccaataatggtggtggt
ttttcaactgttgaatctgctatggtatccctgccacagcaacaaaagcagcatgttggt
ggtcaaaacagccgtatactgcacaaccttggcagccacatgggtagtggtatgaggagt
ggtttgcagcataaatcttatgggttctctaatggggctttaaatggtgggttggggatg
attgggaacaatttacttataaatgaacctggcacttctgagggctatttgacaggcacc
caatatgctaattctcccaagcccttacaacatcactttgatcatcagcgaccaatggtg
cagggtgatggatatggagcgagcaatgctgattcttatgggacagggaacttctatggt
gctgtaacacctgttggatcaatgaccaatactccgaacatgaattcaggaagcttgcag
tctatgcccatagccaaaacaagtgctacgttgatgggtaatcagtctaattttcatggt
gcaacacagggcacacaggttaaggctccatcgattgatcagtccgaaaagatgaatttc
cattcttccttatcttcaagagacaatcttctacagtcacaacaacagcaacaattcccc
caacagccgcatcatgttcaacaacaacaatttgttcaacatcaacgccaacagaagccg
caaagtcagcagcagcatttgttgaacaatgatggttatggtcattctcagatgatgtct
gatatgatcagtcaagtgaagcgtgaacctggaatggagcagcataatgaagttatgcac
tcacaaggtcctgaacaattccagctgcctgagtcacaaaaccaatttcagctaacttct
ggtgaagaccgttcaaggggtgctcagcatctgtctgtttcatctggccagcatgatatc
tgctcatcactaacacaaatgtcccagcctatgcaacaaatgttgcattctcatcagttg
gttgcagattctcataatggttttaactgcttttctataggaggacaatcagaatcagtt
ccgcaaggtcaatggcattctcaatcacaagagaagactcacatggcgggaaacatgtca
catgagcagcatgtccaagaggatttccgccagaggattgctgctcaaggtgaagctcag
cgtaacaatttatcttcggaagtatctgttatcagtcaatctgttggtcctagagtcatg
gcagagcacccaatttcaaggggtgctagctgcagattaaccaatggaaaccgagataga
caatttagaaatcaacagaggtggcttttgttcttgcgccatgctcgccgatgtgctgct
cctgaagggaaatgtcaggatgttaattgcattaccgtccaaaaattatggagacatatg
gacaattgcacttcatctcaatgcccttatcctcgttgccatcattcaaaaattttgatt
caccatcacaagcattgcagggacccaagttgccctgtttgtgttcctgtcaagaactat
ctacagcaacaaaaagaacgtgctcgtccaaaaactgattcttgtttgccgagttcagtt
agtgagtcatgtaaatcttatgatactggagatgcttcaggtgggatgatctctaaaact
ccagcagttgtggagacttcagaagatatacaaccttctctaaaacgaatgaagatagag
ccatcttctcaatctcttgctccagagaacaaaagttctactgtatcagcttctgctatt
gctgaaactcaagtatcccaggatgttctgcaacaagattaccaaaatgtcaagatagga
atgccagtaaaatctgagtttatggaagtgaagatggaagttcctgtaagttctggacag
gggagccctcataataatgagatgaaggatgatgttgttgaaagtaacaaccaaaggcca
gatggtgagcgtattgtatatgatgagcctactgcttcagctaagcaggaaaacaataaa
gttgagaaagagagcgatgtggctaagcaagaaagtttgacacagcctgctgaaaatgct
gctgcaactaagtctggaaagccaaaaataaaaggggtatcactgactgaactattcact
cctgagcaagttagagagcatatttgtggtctcagacagtgggttggccagagtaaagca
aaggcagaaaagaatcaagcaatggagcatgcaatgagtgagaactcttgtcagctgtgt
gcagttgagaagcttacttttgaaccaccacctatttattgctcgccatgtggtactcgt
attaagcgaaatgcaatgtattatacaatgggtgctggtgacacacggcattatttctgt
attaaatgctacaatgaggctcgtggtgatactattgtcgttgatgggactaccattgca
aaggcaaggctggagaagaagaaaaatgacgaggagactgaagaatggtgggttcaatgt
gacaaatgtgaagcctggcaacatcaaatttgtgctttatttaatggtcggaggaatgat
ggtggacaagctgaatatacttgccctaattgctacataacggaggttgaaagaggagag
cgtaagcctttaccacagagtgctgtactgggggccaaagatcttccaaggacaatcctt
agtgatcacatagagcatcgattatttagaagactgaagcaggagagacaagagagggca
aggattcaaggaaaatcatatgatgaggttcctggggctgaagcacttgtaatcagagtt
gtttcatctgttgacaaaaagttggaagtgaagcagcggtttcttgaaattttccaagaa
gagaattaccctacggaatttccttataaatccaaggtagttttgttgtttcagaagatt
gaaggtgtagaagtgtgcctatttggcatgtatgttcaagaatttggatccgaatgccaa
tttcctaatcagcgtcgagtttatctatcatatttggattcggtgaagtattttaggcct
gagattaaagcagttactggagaggcactgcgcacatttgtttatcatgaaattttgatt
ggttaccttgaatattgcaagctgcgtggttttaccagctgctatatttgggcttgccct
ccgctaaagggtgaagactatattttgtattgccatccagaaattcagaaaacaccaaaa
tctgataaactccgagaatggtacttggctatgttaagaaaagctgccagggaaaacatc
gtagttgatctcactaatttatatgatcatttctttgtatccaccggtgaatgtagagct
aaggtaactgcagccaggctgccatattttgatggtgactattggcctggtgctgcagag
gatctaatttaccagattcgtcaagatgaagacgggaaaaaacagaataaggggataacc
aaaaaaaccattacaaaaagggctctaaaagcatctggtcaaactgatctttctggtaac
gcgtcaaaggatctgctacttatgcataagcttggggagaccatttgccctatgaaggaa
gactttattatggttcatctgcagcatgcttgcaatcattgttgtattttaatggtatcg
gggagtcggcatgtgtgcgaacagtgcacaaagctgaacaaaaactttcagctttgtgat
aagtgttttgaagcagaaaagaaacgtgaagatagagagagacatcccgtcaattcgagg
gaagtacacatccttgaggaagttccagttaccgatgtgcctgctgatacgaaagataaa
gatgagattctcgaaagtgaattttttgataccagacaggcatttctgagtctttgtcaa
ggaaatcattatcagtatgataccttgaggcgggctaagcattcatcaatgatggtcctt
tatcatctgcataatccaactgcacctgcatttgtgacgacgtgcaatatatgccatctt
gatatagaaactggtcaaggttggcgctgtgaagtttgcccggattatgatgtatgcaat
gcttgttatcagaaggatggcggtattgatcatccacataaattgacaaaccatccttcc
actgctgatcgcgatgcacagaataaagaagccagacagctacgagtcttgcagcttaga
aaaatgcttgatcttctggttcatgcatcacaatgtcgttctccacactgccaatatcct
aattgccgtaaggtgaaggggcttttccgacatggtatacaatgcaaaacacgtgcgtct
ggaggttgtgtcctttgtaagaaaatgtggtatctcctgcaactccatgctcgagcatgc
aaagagtctgaatgccacgtaccacgctgcagagatctcaaagaacatttgaggaggctc
cagcaacagtctgatacacggagaaggcaggctgtaatggagatgatgaggcagagagct
gcagaggttgctggcaatgctggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system