KEGG   Citrus sinensis (Valencia orange): 102631279Help
Entry
102631279         CDS       T02983                                 

Definition
7-dehydrocholesterol reductase-like
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cit00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    102631279
Enzymes [BR:cit01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     102631279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 437 aa AA seqDB search
MAAATESKTVHSAAVTYVSMISLLTLCPPFVILLWYTMVHADGSVIKSWDYLRQNGLQGF
IDIWPIPTAVAWKLIACFGAFEAALQLLLPGKRVEGPISPTGHRPVYKANGVASYAVTLI
TYLSLWWFGIFNPTIVYDHLGEIYSALIFGSFIFCIFLYIKGHLAPSSTDSGSCGNIIID
FYWGMELYPRIGKNFDIKVFTNCRFGMMSWAVLAVTYCIKQYEANGKVEDSMLVNTILML
IYVTKFFLWEAGYWSTMDIAHDRAGFYICWGCLVWVPSVYTSPGMYLVNHPVHLGTQLAL
FILAAGILCIYINYDCDRQRQEFRRTNGRCLVWGKAPSKIVASYTTSSGETKQSLLLTSG
WWGLARHFHYVPEILAAFFWTVPALFNHFLPYFYVIFLTILLFDRAKRDDDRCRSKYGKY
WKIYCQKVPYRIIPGIY
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagccacagaatcaaagactgttcattcagcagcagtcacctatgtttccatg
atttcactcctcactctctgccctccttttgtcattttgctatggtatacaatggtacat
gctgatgggtctgttatcaaatcatgggactacttgaggcaaaatgggctgcaggggttt
atagatatatggccaatacctactgctgttgcttggaaattaattgcttgtttcggagca
tttgaggctgcacttcagcttcttcttcctggcaaaagggttgagggtccgatttctcct
accgggcatcgcccagtttacaaggcaaatggtgtggcttcatatgcagttacgttaatt
acctatctaagcctttggtggtttggaatattcaaccccaccattgtttatgatcatctg
ggagaaatatattcggcacttatttttggaagcttcatcttttgtattttcttatatatt
aaaggtcacttggccccgtcttccactgattctggttcatgtggaaacataataattgac
ttctactggggtatggagctgtatcctcgaattggcaagaactttgacatcaaagtattc
acaaactgcagatttgggatgatgtcttgggctgttctcgctgtcacttattgtattaag
cagtatgaagcaaatgggaaagtcgaagattccatgcttgtaaatactatattgatgctg
atttatgttacaaaattcttcttgtgggaagctggttactggagcacaatggacattgct
catgatcgagctgggttttatatttgttggggatgcttggtatgggttccttctgtgtat
acatctcctggcatgtacctagttaaccatcctgtgcatcttggcactcagcttgcactt
tttattctagcggcaggcattctttgcatatacatcaattatgattgcgacaggcaaagg
caagaatttcgtagaacaaatggcagatgcctggtttggggcaaagcaccatcaaagatt
gttgcttcatacacaacatcatctggggaaacaaaacaaagccttcttttaacctcaggc
tggtggggtttggcccgtcatttccattatgtacctgaaatattggctgcatttttttgg
actgttccagctctttttaatcattttctaccatacttctacgttatatttcttacgatc
cttcttttcgaccgagctaaaagagacgatgatagatgtcgatccaaatacgggaaatac
tggaaaatatactgccagaaggttccctaccggatcattcctggaatctactga

DBGET integrated database retrieval system