KEGG   Cellvibrio japonicus: CJA_0181Help
Entry
CJA_0181          CDS       T00721                                 

Gene name
pme8C
Definition
pectin methylesterase pme8C (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cja  Cellvibrio japonicus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CJA_0181 (pme8C)
   00500 Starch and sucrose metabolism
    CJA_0181 (pme8C)
Enzymes [BR:cja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     CJA_0181 (pme8C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
236371..237471
Genome map
AA seq 366 aa AA seqDB search
MVRAAAVLAICVLVLGCLYRPGTVRDIHYQARVDKTISAANVYPSIQAALDAAPAAATEP
YRILVASGDYYEKLVINKPNIHIVGAGPASTRLYFDAYAGQSYAQGKTWGTSGSATLTVR
APGVLLQQLTIENTFDFLANDALAVDDPARIQHTQAVALLLDTGSDRFIGRQLHLLGYQD
TLYINAGRSWFDRSLVAGNVDYIFGRGNALFTHSEIRTLGRNKTSFPHGYITAPSTQISD
HYGLTFIHCKLTRVAGVPDNSVPLGRPWHPTTQFADGRYADPNAIGKSVFINTWMDAHIT
RDGWYSMSGTAKDGISKVQFTPEDSRFFEYQSAGPGAQVNSKRRQLSAREAEDYTPEKIL
GEWYPQ
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcgcagctgcggtgctggctatttgtgtgctggtattagggtgtttgtatcgt
ccgggcactgtgcgcgacattcattatcaggcgcgtgttgataaaaccatttctgctgcc
aatgtatatcccagcatccaggctgccttggatgctgcacctgccgcggcgactgagcca
taccgtattttggtggcctctggcgattactacgaaaagctggttatcaataaacctaac
atccatatcgttggtgcaggcccggccagcacgcgcctgtattttgatgcttacgcgggc
cagagctatgcgcagggtaaaacctggggcacgtccggctccgcgaccttgacggtgcgc
gcgcctggcgttttgttacaacaactgacgattgagaatacctttgattttttggcgaat
gatgccttggcagtagatgatccagcgcgtatccagcacacccaggctgttgcactcttg
ctggatactggcagtgatcgctttatcggtcgccaactgcatttgttgggttatcaggat
acgctttatatcaatgcaggccgcagctggtttgatcgcagcctggtagccggtaacgtc
gattatatttttggcagaggcaatgcgctgtttacccattccgagattcgcaccctgggg
cgtaacaaaacaagtttccctcatggttatatcactgcaccctcgacacaaatcagtgat
cattacggtctgacgtttatccattgcaagttaacacgcgttgccggtgtgccggataat
tctgtgcctctggggcgcccctggcatcccacgacccagtttgccgatgggcgctatgcc
gacccgaatgccattggtaaatccgtgtttattaacacctggatggatgcgcacattacc
cgcgatggttggtattccatgagtggcactgccaaagatggtatcagcaaggtgcaattc
acaccggaggattcccgcttctttgaatatcaaagtgcgggaccgggcgcgcaggtaaat
agcaagcgtcgccagctttctgcccgggaggcagaagactatacaccggaaaaaatcctg
ggtgagtggtatccacaataa

DBGET integrated database retrieval system