KEGG   Cellvibrio japonicus: CJA_0185Help
Entry
CJA_0185          CDS       T00721                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cja  Cellvibrio japonicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CJA_0185
   01230 Biosynthesis of amino acids
    CJA_0185
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJA_0185
   00051 Fructose and mannose metabolism
    CJA_0185
   00562 Inositol phosphate metabolism
    CJA_0185
Enzymes [BR:cja01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CJA_0185
Exosome [BR:cja04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CJA_0185
  Exosomal proteins of bladder cancer cells
   CJA_0185
  Exosomal proteins of melanoma cells
   CJA_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(242146..242916)
Genome map
AA seq 256 aa AA seqDB search
MKPRKPIVIANWKLNGGLDLICTSVASFIGKHVDAQIAICPPYLYMRDMMTFLQFSELQI
GSQNVSRYESGAYTGETSAQMLKQAGCSLCLIGHSERRAMFAENNEGCQIKVRTALNHGL
LPVLCVGENQAEREANITEEVLYKQLSEGLANIELNGRDLCIAYEPVWAIGTGLAATPAI
AQSVHQYIRAELARIFDADSAARVRILYGGSVNKTNARDLLLQEDIDGLLVGGASLDPGH
FLAICEQASELAEHTA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacgtaaacccatagtgatcgccaactggaagctcaatggcggcctcgacctg
atttgcacctcggtagcctcgtttatcggcaagcatgtcgacgcgcaaattgccatctgc
ccgccctacctgtacatgcgcgacatgatgaccttcctgcaattttccgaattgcagatc
ggcagccagaatgtcagtcgctatgaatcaggggcctacaccggggagacttcggcgcaa
atgctcaagcaggccggctgctccctgtgcctgattggccactcggagcgccgcgccatg
tttgccgaaaacaacgaaggctgccagatcaaggtgcgcactgcgctcaaccatggactc
ctgcctgtgctgtgcgtgggcgaaaaccaggccgaacgcgaagccaatatcaccgaggaa
gtgctctacaagcagctttccgagggtttggccaatatcgagctgaatgggcgcgatctg
tgcatcgcctacgagccagtgtgggccattggtactggcttggcagcaacaccggcaatc
gcacagtcagtacaccaatacattcgcgctgaactggcgcgtatttttgatgcggacagt
gcggcgcgtgtgcgcatcctttacggcggcagcgtcaacaaaaccaatgcccgcgacctg
ctgttgcaggaggacattgacgggctgctggtcggcggtgccagcctggacccgggccat
ttcctcgccatttgcgaacaggcttcggaactggcagagcataccgcctga

DBGET integrated database retrieval system