KEGG   Cellvibrio japonicus: CJA_0350Help
Entry
CJA_0350          CDS       T00721                                 

Gene name
hex20A
Definition
N-acetyl-beta-hexosaminidase hex20A (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cja  Cellvibrio japonicus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CJA_0350 (hex20A)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CJA_0350 (hex20A)
Enzymes [BR:cja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CJA_0350 (hex20A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
435336..437747
Genome map
AA seq 803 aa AA seqDB search
MKYLLPVLLLVLPFTLVNAADLPLLPYPHSVIQQSGQFLAGNQWNLVIKGKQTAELKTAL
ERFRQRVTLQTGKTIRFVKGREKNAHLFIHIQSSEVIGNSLSSMDESYRLQVRPGRIELH
AEQLVGVVRGLETLLQLVGLQRDVLALPLVDIQDKPRFIWRGLLLDSSRHFFSVASIKRQ
LDIMAAAKFNLFHWHLTDDQGWRLESKKFPRLQQFASDGQYYTREQVRDIVAYARDRGIH
VLPEIDIPGHASAIAVAYPELMSAPGPYAMEYRWGVHKPTLNPANERVYEFVDQLIAEVV
ELFPFDYVHIGGDEVDPQHWQENADIQAFMQANGLVDHLALQAYFNQRVQKILSQHKRNM
IGWDEIQHPDLPNNIVIHSWQGPDGVSNAIRHGFNAILSTGYYLDQPQTAAYHYRQDPLP
QPPFRIDAPAVGESWQSWSFTLPRQRGRPVSGSFTLLDDGKQTRGFIDFAGKSRREVKVH
RYTKNRAQFSLDTWMGPVEFDVNMDQRLGGKAWVGNVAYPVSGKQIAGSNHAQTGLPEPQ
VAPYVLRAEDYARVLGGEVALWSELVDEGTLDLRLWPRALAVAERLWSAQDRRDEVDLYQ
RLETTMTWARMSVGVQDQQQREIALRRLAAGAGIEPLAIFSEALEPAHYYHRQHQKSVSE
TYSKADHLNQLVDALPAENNFKQNQLAIFENELSVLDENDKKYLRKSLKTAFEKWNKNYQ
PLLDLVQKRKDLQGLLPLAERLNVLSELAMELLRNCEASTTLSPAQIVKAQAAVDQAKTM
DQEMVIGAAWVVEKMLQSDAYCP
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatttattgcctgttttgttgttggtactgccgttcaccttggtgaatgcggct
gatttgccgttgttgccttatccgcactcagtgatacaacagtcagggcaatttttagca
ggcaatcaatggaatcttgttataaagggaaagcaaacagcggaattgaaaacagcgctt
gagcgtttccggcagcgagttactttgcagactggaaaaacgattcgctttgttaagggt
agggaaaaaaacgcgcatttattcattcatatccagtcatcggaggtgataggtaatagc
ctgtcctctatggatgaatcctatcgcttacaggttcgtccagggcgtattgaattacac
gccgaacagctggtcggtgttgtgcgcggcctggaaaccctgttgcagttagtggggctg
caacgggatgtgctggctttgcctttggtcgatattcaggataagccccgctttatctgg
cgcggcttgctgctggacagttcccgccatttcttttcagtggcgtcgataaaacgccag
ctggatattatggcagccgccaagttcaatttatttcattggcacctgacggacgatcag
gggtggcgcctggaatccaaaaaatttccacggctgcagcaattcgccagcgatggccag
tattacacccgcgagcaggtgcgcgacatcgtggcttatgcgcgcgaccggggaattcat
gtattgccggaaattgatataccgggacacgccagtgccattgcagttgcctaccctgag
ttgatgtctgcccccggtccctatgccatggagtatcgctggggagtgcacaagccaacg
ctcaatccagccaacgaacgcgtctatgaatttgtggatcaactcatcgctgaagtggtt
gagttattcccatttgactatgtgcacataggtggagatgaagtagatccccagcattgg
caggaaaatgcagacatccaggcatttatgcaggcgaatggattagttgatcatctggcg
ttgcaagcctatttcaaccagcgcgtgcaaaaaatcctgagccagcacaagcgcaacatg
attggctgggacgaaatccagcatccggatttgccgaacaatattgtcatccattcctgg
caggggccggatggtgttagcaatgcgatccgccacggattcaatgccattttgtcaacg
ggctattacctggatcagccacaaacggctgcgtaccattatcgccaggacccactgccc
cagccgccattcaggatagatgctccggcagtgggtgaatcctggcagagctggtccttt
acactgccgcgtcagcgtggcagaccggttagcggatctttcaccttgttagatgacggt
aaacaaacgcgtggatttattgattttgcgggcaaatcccggcgcgaggtgaaggttcat
cgctatacaaaaaatcgcgcgcaattttcgctcgacacctggatgggcccggttgagttt
gatgtgaacatggaccagcggttagggggcaaggcctgggttggcaatgtggcttatccc
gtcagcggtaagcagattgccggtagcaatcacgcccaaacaggtctgcctgagccacag
gttgctccctatgtgttgagggcagaagactatgcccgcgtgcttggcggagaggtggcg
ctctggtccgagttggttgatgaagggaccctggatctgcgcctttggccgcgtgcattg
gctgtggctgaacgcctgtggtcggcccaggataggcgtgatgaagtggatttataccag
cgccttgagacaacgatgacatgggcgcgtatgtcggtgggtgtgcaagatcaacagcag
cgggagatagcgctgcggcgcctggctgccggtgcagggattgagcctttggctatcttc
agtgaggcattggagcctgcccattactaccaccgccagcatcaaaaatcggtctctgaa
acctattcaaaagcagatcatttgaatcaattagtcgatgcattacccgctgaaaataac
ttcaaacaaaaccagctggccatatttgaaaacgaattatccgtgttagatgaaaacgat
aaaaaatacctgagaaaaagcctgaaaactgctttcgagaagtggaataaaaactatcaa
ccactgctggatttggtacaaaaacgtaaagatttgcaaggcttgttgccgctggcagaa
cggttaaatgttttgtcagagttggcaatggaattgcttcgtaattgcgaagcttccacc
accctttcacctgcacaaatcgtcaaagcgcaggccgctgttgaccaggcgaaaacaatg
gatcaggaaatggtgattggtgcagcctgggtggtggaaaaaatgctgcaaagcgatgca
tattgcccctaa

DBGET integrated database retrieval system