KEGG   Cellvibrio japonicus: CJA_0461Help
Entry
CJA_0461          CDS       T00721                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cja  Cellvibrio japonicus
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CJA_0461 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CJA_0461 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CJA_0461 (proB)
Enzymes [BR:cja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CJA_0461 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
565447..566586
Genome map
AA seq 379 aa AA seqDB search
MSAQGFMSKRDIIPQAKRWVVKIGSALLTDDGKGLDAVAIAGWVKQMAELRQRGIELVLV
SSGAVAAGMRRLGWSSRPTEIHQLQAAAAVGQMSLVQTYEVEFQRYGLLTAQVLLDHDDL
SSRQRYLNARSTLKTLVNLQVVPVINENDTVVTDEIRFGDNDTLGALVANLIDADLLVIL
TDQKGMYDSDPRSNPSAQLLNEIAAADPRLEQMAGGGGVLGRGGMITKVRAARVAARSGA
DTIIVGGRIENALLRIAEGESLGTFLWAEQQPQAARKRWLSGQLQTRGTLVLDDGAVRVV
REQGKSLLPVGVKEVRGDFTRGDMVICVDLQGREVARGLVNYHAEEAAKIIGKPSSQIEQ
ILGYRDDNELIHRDNLVLS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctcagggcttcatgagtaaacgtgacattattccccaggcaaagcgctgggtt
gtaaaaattggcagtgccttgctgactgacgatggcaaaggtcttgatgccgtcgctatt
gccggttgggtaaagcaaatggctgagttgcgccagcggggtattgagctggtgctggtg
tcatccggtgcggtggcggcgggcatgcgtcgtttgggttggagttctcgcccgacagaa
atccaccaattgcaagcggcagcagctgttgggcagatgagtttggtgcaaacctatgag
gtggagttccagcgctatggtctgctcacggcacaagtgctgcttgaccatgatgacctt
tcgtcgcgtcaacgttacctcaatgcgcgttctacattaaaaaccctggtgaatttacag
gtagtgccggtcatcaatgaaaacgacaccgtagtaacggatgaaatccgttttggcgat
aacgatacgcttggcgccctggtggctaatttgattgatgcggatttattggtgatcctc
actgatcagaaaggcatgtacgacagcgatcctcgctcgaatcccagcgcacaactgctc
aacgaaattgctgcggctgatcctcgactggaacaaatggcgggtggcggtggtgtgttg
gggcgcgggggaatgattaccaaagtacgcgctgcgcgtgtggcggctcgctctggtgca
gataccattattgtgggtggccggattgagaatgcgttactgcgcatcgccgaaggggaa
agtctggggactttcctgtgggctgaacaacaaccccaggctgcccgtaagcgttggtta
tccggtcaattgcaaacccgcggcaccttggtgcttgatgatggtgctgtacgtgtcgtg
cgtgagcagggcaaaagcttattgcctgtcggtgtaaaagaagtacgcggtgactttacc
cgtggtgatatggttatttgcgtagacctgcagggcagggaagttgctcgtggcttagtg
aattaccacgctgaagaggctgccaaaattattggcaaacccagcagccagattgagcag
atattgggttatcgcgatgataatgaattaatacatcgggataatttggtgttgagctga

DBGET integrated database retrieval system