KEGG   Cellvibrio japonicus: CJA_0532Help
Entry
CJA_0532          CDS       T00721                                 

Gene name
bgl2B
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cja  Cellvibrio japonicus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CJA_0532 (bgl2B)
  Lipid metabolism
   00600 Sphingolipid metabolism
    CJA_0532 (bgl2B)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CJA_0532 (bgl2B)
Enzymes [BR:cja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CJA_0532 (bgl2B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
646550..649342
Genome map
AA seq 930 aa AA seqDB search
MQLFSRSAGDTAGSLSYSHCWLILVLVLGLMLGACSDRPGDAAQASQAADTSPRERILLN
SGWRFMKYPEGKSDALIYDVRPEVINENDAKDADSKPTEAVSVERNQQVLKPWILPSANP
FIADPAKHHTRPQGNPGGDFPLVQADFDDSQWQMVNLPHDWAIAGPFYEGEPALVGGGMG
RLPSPGVAWYRKTLNIPASDVGKRLFLDVEGAMSYAMVWVNGQLAGGWPYGYNSWRLDLT
PYMKAGADNQIAIRLDNPNHSARWYPGGGLYRNVWLTKTQAVHVAQWGTRVTTPEVSSAS
ARIAVDVTVDNQSLRDVTLVTTTHIYALNTRGEREGESLGQVITGPQTLAAGSSALLSGE
LRLANPRLWGPLPQQVPNLYLAHTSVYVGEQLVDTYDTRFGIRQLEFHPTRGVLVNGEAI
YLQGVNQHHDLGALGAAFNRRAAERQLEILREMGVNAIRLAHNPPAPELLELTDAMGFLV
VNEIYDSWERKKTAHDFHLIFPDWYEADLRSLIRRDRNHPSVIMWSVGNEVGEQYTDEAG
AVIARRLHDIVKEEDSTRPTAASFNYAKPQMPITAVMDTISLNYQGEGIRNAPAYSHLQG
IRTEPLYPAFHAAFPDKAIFSSENAAAVSSRGEYLFPVVDGISAPVADGAGGDPVRHQVS
AYELYTAPFGSSADKVLGSLARHPYVAGGFIWSGWDYLGEPTPYYAARSSYFGVIDLAGF
KKDRFYLYQAAWRPELPMVHILPHWNWPGREGQVTPVHLFTSGDEAELFLNGQSLGRKQK
GEYEYRLRWDEVLYQPGELKSVAYKDGKPWAEQRVQTTGPAAAIKLEADRAQIGSAGVDL
SFITASIRDENGLLNPLAMNELRFSLEGPGEIVATDNGDPTSFVPFVSHQRPAFHGLALV
IVRATGPGKITLKATSDGLAAGELVVQATP
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcttttcgagaagtgccggggataccgccggctctctttcctattcccactgt
tggcttatccttgtcttggtgcttggcctgatgctgggggcatgcagtgatcgtccgggg
gatgccgctcaggcatcgcaggcagccgataccagcccgcgtgagcggatactgctcaac
agcggctggcgttttatgaagtaccccgagggcaaatccgatgcactgatttacgatgta
cgccccgaggtcattaatgagaacgatgccaaggacgccgacagcaaacccaccgaagca
gtctctgttgagcgcaaccagcaggtgctcaagccctggatattgcccagtgccaacccc
ttcattgccgatccggccaaacaccatacgcgtcctcaaggtaaccccggtggggatttc
cccctggtgcaggccgacttcgatgatagccagtggcagatggtgaacctgccccacgac
tgggccattgccgggcctttctatgagggtgaaccggcgctcgtcggcggtggcatgggg
cgcttgcccagccccggtgtggcctggtaccgcaaaaccctgaatattcccgccagcgat
gtgggcaagcgcctgttcctggatgtggagggtgccatgtcctatgccatggtgtgggtc
aatggccaattggccggcggttggccctatggctataactcatggcgcctggacctgacc
ccctatatgaaagccggggccgataaccagatcgctattcgcctggacaaccccaatcac
tcagcgcgctggtatccgggcggtggcctgtatcgcaatgtctggctcaccaaaacccag
gctgtgcatgtggcccaatgggggacacgggtaacgacgcccgaggtatccagcgcctct
gcccgtattgcggtggatgtgacagtggacaaccagtccctcagagatgtcaccctggtc
accaccacacacatctacgccctcaatacccggggcgagcgcgagggggagagcctgggg
caggtgatcaccgggccgcaaaccctggcggcgggcagctcggccttgctgagcggtgag
ctgcgccttgccaatccgcgcctctgggggccattgccccagcaagtgccgaacctctac
ctggcccacacttcggtttatgtgggtgaacagttggtagatacctacgacacccgcttt
ggtattcgccaactggagtttcaccccaccaggggcgtgttggtgaacggtgaggcgatt
tatttgcagggtgttaaccagcaccacgacctgggtgccctgggcgcagcctttaaccgt
cgcgctgccgagcgccagttggaaatactgcgcgagatgggcgtcaacgccattcgcctg
gcccataacccgcctgcgccggagctgctggaattgacggatgccatgggctttttggtg
gtcaacgagatttacgattcctgggagcgcaaaaaaaccgcccacgacttccatttgatc
ttccccgattggtacgaggcggacctgcgctcgcttatccgccgcgaccgcaatcatccc
tcggtgattatgtggagtgtgggtaacgaagtgggtgagcaatacaccgatgaggcggga
gcggtaattgcgcgccgcctgcacgacatcgtcaaagaggaagacagtacccgtcccacg
gccgcttccttcaactatgccaagccccagatgcccatcactgcggtgatggataccatt
agcctcaactaccagggtgaaggcattcgcaatgcaccggcctacagccacttgcagggc
atacgcacggaaccgctttatccggcgttccacgcggcctttcccgacaaggcgattttc
agcagcgaaaacgcggcagcggtgagttcgcgcggcgaatacctgttcccggtggtggat
ggcatcagcgcgcctgtcgccgatggtgccggcggtgacccggtgcgccaccaggtcagt
gcctatgaactctataccgcgccctttggctcctctgctgacaaggtattgggttccctg
gcgcgtcacccctatgtggcgggcgggtttatctggagcggttgggattacctgggcgaa
cctacgccttactatgctgcgcgcagctcctattttggggtgatcgacctggcgggcttc
aagaaagaccgtttctacctctaccaggccgcctggcgtccggagttgcctatggtgcat
atactgccccactggaattggccagggcgcgagggccaggtgaccccggtacacctgttt
acctcgggtgatgaagccgagttgttcctcaatggccaatcccttgggcgcaaacaaaaa
ggcgagtacgaataccgcctgcgctgggatgaggtgctttaccagccgggtgaattaaaa
tccgtggcctataaggacggtaaaccctgggccgagcagcgtgtgcaaaccacaggccct
gctgctgcgatcaaacttgaagctgaccgcgcgcagattggcagcgctggagtggatttg
tcgtttattaccgccagcattcgcgatgaaaatggtttactcaatccgctcgcgatgaat
gaactccgctttagcctggaagggccgggggaaattgtcgccaccgacaatggcgacccc
accagctttgtgccctttgtgtcacaccagcgccccgcgttccatggtttggcgttggtc
atcgtgcgcgccacggggccgggaaaaattaccctgaaggcgaccagcgatggattggcg
gccggcgagttggttgtgcaggctacgccttaa

DBGET integrated database retrieval system