KEGG   Cellvibrio japonicus: CJA_0537Help
Entry
CJA_0537          CDS       T00721                                 

Gene name
choB
Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cja  Cellvibrio japonicus
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(653515..656940)
Genome map
AA seq 1141 aa AA seqDB search
MKPISSDLSLIKKHYDIVVIGSGYGGAIAASRLARAGKSVCLLERGREILPGEFPDTLAE
ASEEVQFHLPDKHLGSATALFDIHVEKQQNVVVGCGLGGTSLINANVSLEPTRDVLDSPA
WPAAIRNDPELITGFARAREMLKPVSYPDTQPSLNKLQAHQTSAMKMGAKFSRPPVNVTF
TTPEGGLNHVGVEQKACTLCGDCVSGCNHSAKNTTQMNYLPDAWNHGADIFCLASVRYVE
KQQQQWRIHYQQVGVGREKFDAPLLFVEADIVIVAAGTLGTNEILLRSRAQGLPVSDRLG
HGFTGNGDVLGFGYNCDQPINGIGFGTRKTGQQPPVGPCISGMIDLRDAPIRSQKMVIEE
GSLPGAMGSLLPGALATAAKLIGQDTDDGILDNLREYVRVLESSIRGPYQGAVNNTQTYL
VMSHDDGQGQLRLVNDRLHIDWPGLGEQDNFHAAHHNLVKATSALGGTYVKNPLWSPLLR
NSLVTVHPLGGCCLGDNGSEGAVNHKGQVFSGSGNEVHKGLYVTDGSVIPTSLAVNPLLT
ICAISERCCALIAKDYGWNINYQLPSAPRREHPSTKPGIRFTEVMRGHLALGVDAGDELP
RFLAAEQQGKAKREDIAFALTVYSDDLEQMLALPNHPARISGTLEAKSLSAAPLTITDGE
FSLFERLPSPPDTRQMRYRMRLHAIDGSEYFFDGFKLIKNDAQLFELWTDTTTLYANIYR
GQDTTGTLVAKAVLHIRAADFLRQLTTLKITRVNDKLEQLRHTARFGRFFAGVLYETYGG
VFYKADNQQLPPRKKRPLRAPAPEIYPVKTEDGLDLSLTRYSGGTKGPVLLVHGLGVASS
IFSTDMIETNLVEFLVAHEYDVWLFDYRVSILLPTARLACNGDQVARFDHPAAVAKIREV
TGAASVQALVHCYGSTTFFMSMLAGLQGVRSIVSSQIAADVVVPTATAIKTGLHIPSFLK
RLGVDSLTARLPEDGGSLLTKLYDKALDIYALAEAQGRCNNDSCHRITFMYGSLYQHDRL
NDLLHTHLDELFAEANIETLEHLAAICRAGKLVNAKGDDSYLPHLDRLNLPILFISGADN
ACYLPESTRLTYDKLCQRFGNHQYRREEIPGYAHIDCIFGDRAATDVYPLMLEHLEASCR
P
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctatatcctctgatctttccctgattaaaaaacactatgacattgttgtgata
ggttcgggctatggtggcgcgattgccgcatcgcgcctggccagggcaggcaaatctgtc
tgcctgctggagcggggtcgggaaatattaccgggggagtttcccgacacactcgcggaa
gccagtgaggaagtgcagtttcatttaccggacaaacacctgggttcggcaacggcattg
ttcgatatccatgtggaaaaacaacagaacgtggtggtgggttgcggtttggggggcacg
tcactgattaatgccaatgtatccctggagcctacccgcgatgtgctggacagtccggca
tggcccgccgcgatacgcaacgacccggaattgatcaccggctttgcgcgcgcccgggaa
atgctcaaaccggtgagctatcccgatacccaaccgtcactcaacaaactccaggcgcac
caaacctctgcgatgaagatgggcgccaaattttcccgcccaccggttaacgttaccttc
acaacaccggagggcggcttaaaccatgttggagtggaacaaaaagcctgcaccctgtgt
ggcgattgtgtctctggctgtaatcacagcgcaaaaaataccacgcagatgaattattta
ccggatgcctggaaccatggtgccgatatcttttgcctggccagcgtccgctatgtagaa
aaacagcaacagcagtggcgcatacattaccaacaggtaggtgtgggccgcgaaaaattt
gatgcccccctgttatttgtagaggccgatattgtcatagtcgctgccggcaccctgggc
accaatgaaatcctgctgcgcagccgtgcacagggtttaccggtttccgatcgcctgggc
catggttttaccggcaacggtgatgtgctgggctttggctataactgcgaccaacctatt
aacggcattggttttggtacgcgcaaaaccggtcaacagccccccgtcggcccctgcatc
agcggcatgattgatttgcgcgatgcccccatacgctcacaaaaaatggtgatcgaagag
ggcagtcttcccggtgcgatgggctccctgttacctggagccctggcgacagcggccaag
ttaatcggccaggataccgatgacggcatcctggataatttgcgcgagtatgtgcgtgta
ctggaaagttccattcgcggcccttaccagggcgcggtgaacaatacccaaacctatctg
gtgatgagccacgacgatggccagggccaactgcgcctggtgaatgaccgcctgcacatt
gattggccgggtctgggcgagcaggacaactttcacgctgcacaccacaatttggtcaaa
gccaccagtgcactgggtggtacttatgtgaaaaacccgctctggtctccgctgctgcgc
aatagcctggtaacagttcaccccttgggtggctgttgcctgggagacaatggcagcgaa
ggcgcagtcaaccacaagggtcaggtattcagtggttcgggtaacgaagtgcataagggc
ctgtacgtcaccgatggctccgtaattcccacctcgctggcggtgaatcccttactgacc
atttgtgccatcagcgaacgctgctgtgctttaatcgccaaggattacggttggaatatt
aattaccagttgccctccgcacccaggcgcgagcatccatcaaccaagcccggcattcgc
tttacggaggtaatgcgcggccacctggcgctgggtgtcgatgcaggggatgaactgcct
cgcttcctggccgccgaacagcaaggtaaggcaaagcgcgaggacatcgcctttgccctg
accgtatacagcgatgacctggaacagatgctggcgctgcccaatcacccggcgcgcatc
agcggaaccctggaagccaaatcgctttccgccgcaccactgaccattaccgacggtgag
ttttcattatttgaacgcctgcccagcccgccggatacacgccagatgcgctatcgcatg
cgcctgcacgctatcgatggcagcgagtatttttttgatggattcaaactgattaaaaac
gatgcgcaattattcgagttgtggacagataccaccacgctctatgccaacatctatcgc
ggccaggacacaaccggcaccctggttgccaaagcggtattgcatattcgcgccgctgat
tttttacggcaattgaccaccctgaaaattacccgggtaaatgacaagctggagcaattg
cgccacaccgcacgcttcgggcgtttttttgccggggtattgtatgaaacctacggtggt
gtgttttacaaagccgacaaccagcaattacctccgcgcaaaaagcgcccgttgcgcgcc
ccggcaccggagatctatccggtcaagacggaagatggcctcgacttgagcctgacgcgc
tatagcggcggcaccaaaggccctgtgctgttggtacatggcctgggtgtggcatcgagt
attttttccaccgatatgattgagaccaacctggtggaattcctggttgcgcatgaatac
gatgtgtggctgtttgattatcgcgtcagtattttattgccgacagccaggttggcgtgc
aatggcgaccaggtcgcccgctttgatcaccccgccgcagttgccaaaattcgtgaggtt
accggtgctgccagtgtgcaggcattggtgcattgttatggctcgactaccttttttatg
tcgatgctggccggactgcaaggtgtgcgctctattgtcagctcacagattgctgccgat
gtggttgtacctacggcgacagccatcaaaaccggcttgcacattcccagcttcctcaag
cgcctgggtgtcgattcgctaacagcacgcctgcccgaggatggcggctcactgctcacc
aaactctacgacaaagcccttgatatctatgccctggccgaagcccagggacgctgcaat
aacgactcctgccaccgcattacgtttatgtatggctcgctctaccaacacgatcgcctg
aacgatctactgcatacccacctggatgaattatttgccgaagccaatatcgaaaccctg
gagcacttagccgcgatttgtcgcgcggggaaattggtaaatgccaagggcgatgacagt
tatctaccgcacctggatcgcttgaacctgcccatcctgtttatttccggtgccgataac
gcatgctacctgccggaaagtacccggctcacctacgacaaactgtgccaacgttttggc
aaccaccaataccggcgcgaggaaattccgggctatgcccatatcgattgtatttttggt
gacagggccgccacggatgtctatccgttgatgctggaacatttggaggcaagctgtcgc
ccctag

DBGET integrated database retrieval system