KEGG   Cellvibrio japonicus: CJA_0537Help
Entry
CJA_0537          CDS       T00721                                 

Gene name
choB
Definition
(GenBank) cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
cja  Cellvibrio japonicus
Pathway
cja01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    CJA_0537 (choB)
Enzymes [BR:cja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     CJA_0537 (choB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N Pyr_redox_2 FAD_oxidored FAD_binding_2 DAO Pyr_redox NAD_binding_8 Abhydrolase_1 FAD_binding_3 GIDA HI0933_like TctA Fer4_9 Fer4_6 Lycopene_cycl Abhydro_lipase Abhydrolase_6 Fer4_2
Motif
Other DBs
NCBI-ProteinID: ACE85653
UniProt: B3PJ26
Position
complement(653515..656940)
Genome map
AA seq 1141 aa AA seqDB search
MKPISSDLSLIKKHYDIVVIGSGYGGAIAASRLARAGKSVCLLERGREILPGEFPDTLAE
ASEEVQFHLPDKHLGSATALFDIHVEKQQNVVVGCGLGGTSLINANVSLEPTRDVLDSPA
WPAAIRNDPELITGFARAREMLKPVSYPDTQPSLNKLQAHQTSAMKMGAKFSRPPVNVTF
TTPEGGLNHVGVEQKACTLCGDCVSGCNHSAKNTTQMNYLPDAWNHGADIFCLASVRYVE
KQQQQWRIHYQQVGVGREKFDAPLLFVEADIVIVAAGTLGTNEILLRSRAQGLPVSDRLG
HGFTGNGDVLGFGYNCDQPINGIGFGTRKTGQQPPVGPCISGMIDLRDAPIRSQKMVIEE
GSLPGAMGSLLPGALATAAKLIGQDTDDGILDNLREYVRVLESSIRGPYQGAVNNTQTYL
VMSHDDGQGQLRLVNDRLHIDWPGLGEQDNFHAAHHNLVKATSALGGTYVKNPLWSPLLR
NSLVTVHPLGGCCLGDNGSEGAVNHKGQVFSGSGNEVHKGLYVTDGSVIPTSLAVNPLLT
ICAISERCCALIAKDYGWNINYQLPSAPRREHPSTKPGIRFTEVMRGHLALGVDAGDELP
RFLAAEQQGKAKREDIAFALTVYSDDLEQMLALPNHPARISGTLEAKSLSAAPLTITDGE
FSLFERLPSPPDTRQMRYRMRLHAIDGSEYFFDGFKLIKNDAQLFELWTDTTTLYANIYR
GQDTTGTLVAKAVLHIRAADFLRQLTTLKITRVNDKLEQLRHTARFGRFFAGVLYETYGG
VFYKADNQQLPPRKKRPLRAPAPEIYPVKTEDGLDLSLTRYSGGTKGPVLLVHGLGVASS
IFSTDMIETNLVEFLVAHEYDVWLFDYRVSILLPTARLACNGDQVARFDHPAAVAKIREV
TGAASVQALVHCYGSTTFFMSMLAGLQGVRSIVSSQIAADVVVPTATAIKTGLHIPSFLK
RLGVDSLTARLPEDGGSLLTKLYDKALDIYALAEAQGRCNNDSCHRITFMYGSLYQHDRL
NDLLHTHLDELFAEANIETLEHLAAICRAGKLVNAKGDDSYLPHLDRLNLPILFISGADN
ACYLPESTRLTYDKLCQRFGNHQYRREEIPGYAHIDCIFGDRAATDVYPLMLEHLEASCR
P
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctatatcctctgatctttccctgattaaaaaacactatgacattgttgtgata
ggttcgggctatggtggcgcgattgccgcatcgcgcctggccagggcaggcaaatctgtc
tgcctgctggagcggggtcgggaaatattaccgggggagtttcccgacacactcgcggaa
gccagtgaggaagtgcagtttcatttaccggacaaacacctgggttcggcaacggcattg
ttcgatatccatgtggaaaaacaacagaacgtggtggtgggttgcggtttggggggcacg
tcactgattaatgccaatgtatccctggagcctacccgcgatgtgctggacagtccggca
tggcccgccgcgatacgcaacgacccggaattgatcaccggctttgcgcgcgcccgggaa
atgctcaaaccggtgagctatcccgatacccaaccgtcactcaacaaactccaggcgcac
caaacctctgcgatgaagatgggcgccaaattttcccgcccaccggttaacgttaccttc
acaacaccggagggcggcttaaaccatgttggagtggaacaaaaagcctgcaccctgtgt
ggcgattgtgtctctggctgtaatcacagcgcaaaaaataccacgcagatgaattattta
ccggatgcctggaaccatggtgccgatatcttttgcctggccagcgtccgctatgtagaa
aaacagcaacagcagtggcgcatacattaccaacaggtaggtgtgggccgcgaaaaattt
gatgcccccctgttatttgtagaggccgatattgtcatagtcgctgccggcaccctgggc
accaatgaaatcctgctgcgcagccgtgcacagggtttaccggtttccgatcgcctgggc
catggttttaccggcaacggtgatgtgctgggctttggctataactgcgaccaacctatt
aacggcattggttttggtacgcgcaaaaccggtcaacagccccccgtcggcccctgcatc
agcggcatgattgatttgcgcgatgcccccatacgctcacaaaaaatggtgatcgaagag
ggcagtcttcccggtgcgatgggctccctgttacctggagccctggcgacagcggccaag
ttaatcggccaggataccgatgacggcatcctggataatttgcgcgagtatgtgcgtgta
ctggaaagttccattcgcggcccttaccagggcgcggtgaacaatacccaaacctatctg
gtgatgagccacgacgatggccagggccaactgcgcctggtgaatgaccgcctgcacatt
gattggccgggtctgggcgagcaggacaactttcacgctgcacaccacaatttggtcaaa
gccaccagtgcactgggtggtacttatgtgaaaaacccgctctggtctccgctgctgcgc
aatagcctggtaacagttcaccccttgggtggctgttgcctgggagacaatggcagcgaa
ggcgcagtcaaccacaagggtcaggtattcagtggttcgggtaacgaagtgcataagggc
ctgtacgtcaccgatggctccgtaattcccacctcgctggcggtgaatcccttactgacc
atttgtgccatcagcgaacgctgctgtgctttaatcgccaaggattacggttggaatatt
aattaccagttgccctccgcacccaggcgcgagcatccatcaaccaagcccggcattcgc
tttacggaggtaatgcgcggccacctggcgctgggtgtcgatgcaggggatgaactgcct
cgcttcctggccgccgaacagcaaggtaaggcaaagcgcgaggacatcgcctttgccctg
accgtatacagcgatgacctggaacagatgctggcgctgcccaatcacccggcgcgcatc
agcggaaccctggaagccaaatcgctttccgccgcaccactgaccattaccgacggtgag
ttttcattatttgaacgcctgcccagcccgccggatacacgccagatgcgctatcgcatg
cgcctgcacgctatcgatggcagcgagtatttttttgatggattcaaactgattaaaaac
gatgcgcaattattcgagttgtggacagataccaccacgctctatgccaacatctatcgc
ggccaggacacaaccggcaccctggttgccaaagcggtattgcatattcgcgccgctgat
tttttacggcaattgaccaccctgaaaattacccgggtaaatgacaagctggagcaattg
cgccacaccgcacgcttcgggcgtttttttgccggggtattgtatgaaacctacggtggt
gtgttttacaaagccgacaaccagcaattacctccgcgcaaaaagcgcccgttgcgcgcc
ccggcaccggagatctatccggtcaagacggaagatggcctcgacttgagcctgacgcgc
tatagcggcggcaccaaaggccctgtgctgttggtacatggcctgggtgtggcatcgagt
attttttccaccgatatgattgagaccaacctggtggaattcctggttgcgcatgaatac
gatgtgtggctgtttgattatcgcgtcagtattttattgccgacagccaggttggcgtgc
aatggcgaccaggtcgcccgctttgatcaccccgccgcagttgccaaaattcgtgaggtt
accggtgctgccagtgtgcaggcattggtgcattgttatggctcgactaccttttttatg
tcgatgctggccggactgcaaggtgtgcgctctattgtcagctcacagattgctgccgat
gtggttgtacctacggcgacagccatcaaaaccggcttgcacattcccagcttcctcaag
cgcctgggtgtcgattcgctaacagcacgcctgcccgaggatggcggctcactgctcacc
aaactctacgacaaagcccttgatatctatgccctggccgaagcccagggacgctgcaat
aacgactcctgccaccgcattacgtttatgtatggctcgctctaccaacacgatcgcctg
aacgatctactgcatacccacctggatgaattatttgccgaagccaatatcgaaaccctg
gagcacttagccgcgatttgtcgcgcggggaaattggtaaatgccaagggcgatgacagt
tatctaccgcacctggatcgcttgaacctgcccatcctgtttatttccggtgccgataac
gcatgctacctgccggaaagtacccggctcacctacgacaaactgtgccaacgttttggc
aaccaccaataccggcgcgaggaaattccgggctatgcccatatcgattgtatttttggt
gacagggccgccacggatgtctatccgttgatgctggaacatttggaggcaagctgtcgc
ccctag

DBGET integrated database retrieval system