KEGG   Cellvibrio japonicus: CJA_0619Help
Entry
CJA_0619          CDS       T00721                                 

Gene name
cel5H
Definition
endo-1,4-beta glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cja  Cellvibrio japonicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CJA_0619 (cel5H)
Enzymes [BR:cja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CJA_0619 (cel5H)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(752845..753897)
Genome map
AA seq 350 aa AA seqDB search
MNRPWRLLTGLLGGWLAPACLAVCLSAERLTGVNLAGAEFNSKKLPGVFNKDYTYPTQAE
LVFSASQGANVIRLPFRWERLQPQANGLLDSAELGRLKTTVEAAYGQGLCVILDVHNYAK
YFGQSLGDEPALEEAFINLWLALAREFPDADKTAFGLMNEPAYMPLERWTALAQRTLAAL
RNAKAPNLVLLGGGGWNGLHSWFNEQDGVSNANSLAGLEDPLKRTIIEVHQYADSNYSGT
RQECLAADHFDSRFERIRAWADAQGLQLFLGEFGVAPNSQCLATLTRFLELMDNAQWKGW
TYWAAGRWWGSYAFALNTSSTEPSAQWALLRQFFFRPALSPPLPPTRNES
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtccctggcgcttgctgaccggcctgctgggcggctggctggcaccggcgtgc
ctggcggtctgcctaagtgccgagcgcttgaccggtgtcaacctggccggggccgagttc
aattccaaaaaactgcccggcgtgttcaacaaggattacacctaccccacccaggccgag
ctggtatttagcgccagccagggcgccaatgtgatccgcctgccgtttcgttgggagcgt
ttacagccccaggccaacgggttgctggacagcgccgaactggggcgccttaaaaccacg
gttgaggccgcctatggccaggggctgtgtgtgatcctggatgtacacaactacgccaaa
tacttcggccaaagcctgggcgatgagcctgcactggaagaggcctttatcaacctctgg
ctggcgctggcccgcgagtttcccgatgccgacaagaccgccttcgggctgatgaacgag
cccgcctatatgccgctggagcgctggaccgccctggcacagcgcaccctggcggccctg
cgcaacgccaaggcacccaacctggtgctgctcgggggtggcggctggaacggtttgcac
agttggttcaatgagcaggatggcgtctccaatgccaatagcctggcggggctggaggat
ccactcaagcgaaccattatcgaggtacaccagtacgccgacagcaactattcgggcacc
cgccaggagtgcctggcagccgatcattttgatagccgctttgagcgtatccgcgcctgg
gccgatgcccagggcctgcaactgtttctgggcgagttcggcgtcgcgcccaacagccag
tgcctggcaaccctgacccgcttcctggaactgatggataacgcccaatggaaaggctgg
acctactgggccgccgggcgctggtggggcagctacgcctttgcgctcaacaccagcagc
accgaaccctcggcccagtgggccttgctacggcaattcttttttcgcccggcattaagt
ccacccctgccgcccacacgcaacgaatcctga

DBGET integrated database retrieval system