KEGG   Cellvibrio japonicus: CJA_0646Help
Entry
CJA_0646          CDS       T00721                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cja  Cellvibrio japonicus
Pathway
cja00900  Terpenoid backbone biosynthesis
cja01100  Metabolic pathways
cja01110  Biosynthesis of secondary metabolites
cja01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CJA_0646 (ispE)
Enzymes [BR:cja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CJA_0646 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACE86027
UniProt: B3PJN8
Position
complement(783295..784140)
Genome map
AA seq 281 aa AA seqDB search
MNALRLLSPAKLNLFLHITGRRADGYHLLQTLFQLLDYGDELYFEIRDHGPITLAPALPS
VDFEQNLIIRAARALEPYKPKPLGVDIQLTKRLPMGGGIGGGSSNAATTLVALNHLWQCG
LSKQQLQTLGLQLGADVPVFVNAQTAWAEGVGESLQPIEIPPKWFLVVQPDCHVSTAEIF
SHGDLTRDTAAIKVAAFLERGGQNDCEVLVRKLYPQVDEALNWLQQFDRHARMTGTGACV
FASFDSVEKAQWVQTQLPAHLPGFVAKGVNQSPLYKLLPAS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccctgcgcctgctgtccccggccaagctcaacctgttcctgcacatcaccggg
cgtcgtgccgatggctatcacctgctccaaaccctgttccagttgctcgattatggcgat
gaactctacttcgaaatacgcgaccatggccctattaccctggccccggccctgcccagt
gtcgattttgagcagaacctgattatccgcgcagcgcgcgcactggaaccctacaaaccc
aagccgctcggcgtcgatatacaactcaccaagcgcctgcccatgggcggcggcattggc
ggtggcagcagcaatgccgccaccaccctggttgcgctcaaccatctctggcaatgcggc
ctcagcaagcagcagttgcaaaccctgggcttgcaactgggcgctgatgtgcccgtgttc
gtcaacgcccaaaccgcctgggcagaaggtgtcggcgaaagcctgcaacctattgaaata
ccgccaaaatggttccttgttgtgcaacctgattgccatgtatccactgcagaaattttt
tctcacggggatttgacaagagacacggcggccattaaagtggcggccttccttgaacgg
ggtggtcaaaacgactgcgaagtcctggtgagaaagctgtatccgcaagtggatgaagca
ctcaactggctgcaacaattcgatcgccacgcacgcatgacgggaaccggagcctgtgtt
tttgccagcttcgattcggtagaaaaagcgcaatgggtacaaacacaattgcctgcacat
ctacccggctttgtagccaaaggggttaaccaatccccgctctacaagctgcttcccgcc
agctga

DBGET integrated database retrieval system