KEGG   Cellvibrio japonicus: CJA_0731Help
Entry
CJA_0731          CDS       T00721                                 

Gene name
gla15
Definition
glucan 1,3-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
cja  Cellvibrio japonicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CJA_0731 (gla15)
Enzymes [BR:cja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CJA_0731 (gla15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(857232..859643)
Genome map
AA seq 803 aa AA seqDB search
MKRSLFALAISSAFFVAACSDKSPTSTSTTDQTAPGAPGAPALWSYSGKTGIGTSYEQYL
NGQYSDAAATGTVSKVWFSLAQGILTETMYGLIHEAQLRELQFFIKGDDFLDEEKTDTQS
EISYLKTDEQGRPLSLAYKLINTDKDGKYRIEKHIFTDPDSQSLMMRVKFTALADGITPY
LYADTALANTGSNDSASYVDGVLTASEGNTSMSLKTTAHIVQGSVGFVGVSDGISELKAT
GSMTKTYTTTGDTAGNVGMTLQLASLNHGQTVEFDLALGFGQSPAESRTAAELTLAKGYD
KVLAHYNGDGDAIGWQDYLQSLPALNNLAATATDGGKLLYTSALVLKAQEDKTHAGALIA
SLSNPWGDIKSAEHSATGYKAVWPRDFYQVAMAMLALGDTQSPRVAFEYLQKVQVNSSTP
GYEGTPGYFLQKTHVDGTIEWIAVQMDQTAMPIMLGWRLWKEGVLSDSDITGWYHKMLKP
AADFLTDGGKVKIDWIDTEIKPPFTQQERWEEQQGYSPSTIAAIIAGLVSAADIARQSGD
NANAERYQSAADDFSANLEKYTFTTQGSLTGTQGNGQYYLRITQNQDPNDRAPLDNRNGQ
DITDESLVIDGGFLELVRYGVRSATHPQVLETIPEYDNLQLPDVLRTKYEFTFPGIEGKF
PGWRRYGIDGYGEDITNGAGYAAVNDTSTPGQRGRVWPFFTGERGHYELALAKASHTLDI
NNLRSIYVKGMELFANEGMMLPEQVWDGVGDNSVYHYQLGQGTNSATPLAWTHAEYIKLL
RSYSDGKVWDRNASTEARYVKSE
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaagcctgtttgcactggccatcagcagtgcgttttttgttgccgcctgctcc
gacaaatccccgacaagcacgtctacaacagatcaaacagcgccaggtgcccccggtgct
cctgcgctttggtcttactcgggtaagaccggtatcggtacctcttatgagcaatacctc
aatggacaatacagtgatgccgccgcgacgggtacggtttccaaagtctggttttccctt
gcccagggcatcctgaccgaaaccatgtacggattgatccacgaggcacagctgcgtgag
ttgcaatttttcatcaaaggcgatgactttcttgatgaagaaaaaacggatacccaatcc
gaaatcagttatctgaaaaccgatgaacaaggccgcccgttatcgctggcctataaattg
attaataccgataaagatggcaaataccgcatcgaaaaacatatttttaccgatccggac
agtcagtcactgatgatgcgcgtgaagttcaccgcactcgccgatggtattacgccctac
ctttatgccgataccgcacttgccaatactggcagcaatgacagtgccagctatgtcgat
ggtgtgcttaccgcgagtgaaggcaataccagcatgagcctgaaaacgacagcgcacata
gtgcagggcagcgtgggatttgtcggtgtctctgacggcattagcgaattgaaagccacc
ggcagcatgacaaaaacctacaccaccaccggtgataccgccggcaatgtggggatgacc
ttgcaattggccagcctcaatcatgggcaaacagtggaatttgatctggccctgggtttt
ggccaatctccagcagaaagccgtacagctgctgagctaacgctggcgaaaggctacgac
aaggtattagcccattacaacggcgatggcgatgccatcggctggcaggattacctgcaa
tcactgccggcgcttaacaacctggccgcgacagcaaccgatggcggcaagctgctttat
accagtgcgctggtactcaaggcacaggaagacaaaacccatgcgggtgccttgattgca
tccttgtccaatccctggggcgacatcaagtcagccgaacactcggcgacaggctacaag
gcggtttggccacgcgacttctatcaggtcgccatggcaatgctcgccctgggcgatacg
caatcgcccagggtagcctttgaatatttgcaaaaagtgcaagtgaacagcagcactccc
ggttacgaaggtacccccggttatttcctgcagaagacccatgtggatggcaccatcgaa
tggattgccgtgcagatggatcaaaccgctatgcctatcatgcttggctggcgcctgtgg
aaagagggggtactgagtgatagtgatatcaccggctggtaccacaaaatgcttaaaccg
gccgccgatttcctcaccgatggcggcaaggtgaagatcgactggatcgataccgagatc
aaaccaccctttacccagcaagagcgctgggaagagcaacagggttattcgccttcgacc
atcgcggccattattgcggggctggtttccgccgcggatatcgcccggcaatccggtgat
aatgccaatgccgaacgctaccagagtgcggcggatgatttctcggcaaacctggaaaaa
tacaccttcaccacccagggctccctgaccggtacgcaaggcaatggacagtactatctg
cgtattacccagaatcaggatccgaacgaccgcgcgcccctggacaaccgcaatggccag
gatattaccgatgagtcactggtaatcgatggcggcttcctggagctggtgcgctacggc
gtgcgctccgccacccacccccaggtgctggaaaccataccggaatatgacaacctgcaa
ttaccggatgtgctgcgcaccaaatacgaattcactttcccggggatagagggcaaattc
ccgggctggcgccgttacggcatagatggttatggcgaagacattaccaatggcgccggt
tatgccgcggttaacgataccagcacacccggtcaacgcggtcgtgtctggccctttttt
accggcgagcgcggccactatgaattagcgctggctaaagccagccataccctggacatc
aacaacctgcgcagcatctatgtgaaaggcatggagctgtttgccaacgaggggatgatg
ctcccggagcaggtctgggacggcgttggggacaattcggtgtatcactaccagttgggc
caaggcaccaactcggcaactcccctggcatggactcacgccgaatatatcaagctgctg
cgcagttacagcgatggcaaggtctgggatcgcaatgcaagcactgaagcgcgctatgtc
aaaagcgaatag

DBGET integrated database retrieval system