KEGG   Cellvibrio japonicus: CJA_0943Help
Entry
CJA_0943          CDS       T00721                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cja  Cellvibrio japonicus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CJA_0943
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CJA_0943
Enzymes [BR:cja01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CJA_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1101067..1101582
Genome map
AA seq 171 aa AA seqDB search
MTSPFFQFTADSLAGQPVSLADYSGRWVLVVNTASQCGFTPQYAGLEQLYQKYRDKGLVI
LGFPCNQFGGQEPGDASDIAQTCQVNYGVTFPMFAKIDVNGADAHPLFHWLKAALPGLLG
QSIKWNFTKFLLDPEGKPVKRFATVTKPEAIDRYLQAKIRSQHSSTARAGE
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtcccttcttccagtttacggccgatagcctggccggccagccggtatccctg
gcggattacagcggacggtgggtgctggttgtaaacacggccagccaatgcggttttacc
ccgcaatatgccggcctggaacagctctaccagaaatacagggataaggggttggtgatc
ctggggttcccttgtaaccagtttggcgggcaggagccgggcgatgccagtgatattgcc
caaacctgccaggttaactacggggtgacctttcccatgtttgccaagattgatgtgaat
ggtgctgatgcccacccgctgtttcattggctcaaggcggcgttgcccggtttactgggg
caatcgattaaatggaatttcaccaagttcctgcttgatcccgagggaaaaccggtcaaa
cgttttgcgacagtgaccaaacctgaagccatcgatcgttatcttcaggcgaaaattcgc
agtcaacacagctcgacagcccgggcgggggaatag

DBGET integrated database retrieval system