KEGG   Cellvibrio japonicus: CJA_1030Help
Entry
CJA_1030          CDS       T00721                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cja  Cellvibrio japonicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cja00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CJA_1030 (ruvA)
Enzymes [BR:cja01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CJA_1030 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1211340..1211957
Genome map
AA seq 205 aa AA seqDB search
MIGRLKGILIEKQPPYLLLDVNGVGYELQAPMTTFYRLPSLGHEVVLHTHLSITENLHQL
FGFAEQRDRSLFRTLIKVNGVGPKLAVAILSGMESDDIARCVRDNNIKALTRVPGIGQKT
AERLVIELRDRLKNWDLPQGDMLAHGEIQAIASDNDIYAEAESALIALGYKPVDAAKMVA
SAAKQKPEARSEELIRIALRSLAGV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcttgaaaggcatcctcatcgaaaagcaacctccttatttattgctggac
gtcaatggtgtcggctacgaactccaggcgcccatgaccaccttctatcgtttaccttca
ctgggtcacgaagttgtgctacacacgcacctctccattacagaaaacctgcaccaatta
tttggttttgctgaacagcgcgacaggtctttattccgcaccctgatcaaggtgaatggt
gtaggccccaagctggccgttgcgattttgtccgggatggaatcggatgatattgcccgc
tgtgtgcgcgataacaatattaaggcgctcaccagggtgccggggattggccagaaaacg
gcggagcgcttggttattgaactgcgtgatcgccttaaaaactgggatttgccccagggc
gatatgcttgctcatggtgaaattcaggcgattgccagtgataacgatatctatgccgaa
gcggaaagcgcgctgattgcactcggctacaagccggtggatgccgctaaaatggtggca
tccgctgccaagcagaaacctgaggcgcgcagtgaagaacttatccgcatcgctctgcga
agccttgccggtgtataa

DBGET integrated database retrieval system