KEGG   Cellvibrio japonicus: CJA_1337Help
Entry
CJA_1337          CDS       T00721                                 

Gene name
gt4H
Definition
glycosyl transferase family protein (EC:2.3.1.12 2.4.1.-)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cja  Cellvibrio japonicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:cja01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cja00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cja00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cja00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1558901..1560466
Genome map
AA seq 521 aa AA seqDB search
MAIQSIKVPDIGGAEGVEVIEISVKVGDVVAEGDSIVVLETDKASMEIPADVAGKVVAIK
INVGDKVSQGDLLIDVEAEGAGAAAEPAPVAAPAPAAPAPAAASAEVAVVVPDIGGAEGV
DVIEVNVNVGDEVSAGDTLIVLETDKASMEVPAEVAGKVVSLAIKVGDKVSQGSAIGVIA
TTGAAPKADAAKAEAPKAEAPKPAAAPAPVAAKVEEIVQTGDVYAGPAVRKLARQLGVDL
GKVSGTGPRGRLLKDDVRTYVKPIVQAAQSGAAVGGAGIPRVPAVDFAKFGEIETVKMSK
VKKITADNMTRNWLNIPHVTQWDDADITDLEAFRNSLKAEAEKRGSKLTPLPFLLKAAAA
ALVAEPSFNVSLHHDGESIVHKKYVHIGIAVDTPNGLMVPVIRNVDKKGLWELTDDINAI
VKKARDGKLLPADMQGGCFTISSLGAAGGNGFTPIVNAPEVAILGVSRAQMKPVWNGKEF
VPRNMLPLSLSYDHRAINGADAGRFFTYLTAVVADVRRLLL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtggcaattcaatcaatcaaagtgcccgatattggcggtgcagaaggcgttgaagtaatc
gaaatctccgtcaaggtgggcgatgtagtcgccgagggtgattcgattgtcgtgcttgag
accgacaaagcttcaatggaaattcctgccgatgtcgcgggcaaggttgtcgctattaaa
ataaatgtgggggataaagtatcccagggtgatctgctgattgatgtagaagctgaaggg
gctggcgctgctgccgaaccggcacctgtcgctgcacctgctccggcggcacccgccccc
gctgctgccagcgctgaagtggcggtagttgtacccgacatcggtggcgcggaaggtgtt
gatgttattgaggttaacgtcaatgtcggcgatgaagtttccgcaggtgataccctgatc
gtgttggaaaccgacaaagcctctatggaagttcctgccgaagtcgccggtaaagttgtc
agcctggcaatcaaggtaggcgataaagtatcccagggcagtgctatcggcgtgattgct
acgaccggcgcggcacccaaggcagacgctgccaaagcggaagcgccgaaagcagaggcg
cccaagccagctgctgctccagcacccgttgccgccaaggtagaagaaattgtacaaacc
ggtgatgtatatgcaggccccgccgtgcgcaaactggctcgccaactgggcgtggatctg
ggcaaggtcagcggtacgggcccccgcggtcgcttgctgaaagatgatgtacgcacttac
gttaagcctatcgtacaggctgcacaatcgggtgctgcagttggtggtgcaggtattcct
cgtgtgccggcggtggacttcgccaagtttggtgaaattgaaacggtgaaaatgtccaag
gtgaagaaaatcactgccgacaatatgacccgtaactggctcaatatcccccatgttacc
caatgggatgatgcggatatcaccgaccttgaagccttccgcaatagcctcaaggccgaa
gccgaaaaacgcggtagcaaactgacccccctgccattcctgttgaaagccgctgccgct
gcgctggttgccgagccaagttttaatgtgtctttacatcacgatggcgaaagtattgtg
cataagaagtatgtgcacattggtattgccgtagacacgcccaatggtttgatggtgcct
gtcattcgcaacgttgataagaaaggcctgtgggaactgactgacgacatcaacgctatc
gtgaaaaaagcgcgcgatggcaaactgctgccggccgatatgcaaggtggctgcttcact
atttccagcctgggggctgccggtggtaatggtttcacgcctatcgtgaacgcaccggaa
gtggctatcctcggtgtgtcgcgcgcgcaaatgaaacccgtctggaatggcaaggagttt
gtgccgcgcaatatgttgccgctgtcactctcctacgatcaccgcgccattaatggcgct
gatgcgggccgtttcttcacttacctgaccgcggtagtcgctgatgtaagacgcttgctg
ttgtaa

DBGET integrated database retrieval system