KEGG   Cellvibrio japonicus: CJA_1337Help
Entry
CJA_1337          CDS       T00721                                 

Gene name
gt4H
Definition
(GenBank) glycosyl transferase, putative, gt4H
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cja  Cellvibrio japonicus
Pathway
cja00010  Glycolysis / Gluconeogenesis
cja00020  Citrate cycle (TCA cycle)
cja00620  Pyruvate metabolism
cja01100  Metabolic pathways
cja01110  Biosynthesis of secondary metabolites
cja01120  Microbial metabolism in diverse environments
cja01130  Biosynthesis of antibiotics
cja01200  Carbon metabolism
Module
cja_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJA_1337 (gt4H)
   00020 Citrate cycle (TCA cycle)
    CJA_1337 (gt4H)
   00620 Pyruvate metabolism
    CJA_1337 (gt4H)
Enzymes [BR:cja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CJA_1337 (gt4H)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 NQRA HlyD_D23 RnfC_N Peptidase_M23 PASTA
Motif
Other DBs
NCBI-ProteinID: ACE85484
UniProt: B3PCX4
Position
1558901..1560466
Genome map
AA seq 521 aa AA seqDB search
MAIQSIKVPDIGGAEGVEVIEISVKVGDVVAEGDSIVVLETDKASMEIPADVAGKVVAIK
INVGDKVSQGDLLIDVEAEGAGAAAEPAPVAAPAPAAPAPAAASAEVAVVVPDIGGAEGV
DVIEVNVNVGDEVSAGDTLIVLETDKASMEVPAEVAGKVVSLAIKVGDKVSQGSAIGVIA
TTGAAPKADAAKAEAPKAEAPKPAAAPAPVAAKVEEIVQTGDVYAGPAVRKLARQLGVDL
GKVSGTGPRGRLLKDDVRTYVKPIVQAAQSGAAVGGAGIPRVPAVDFAKFGEIETVKMSK
VKKITADNMTRNWLNIPHVTQWDDADITDLEAFRNSLKAEAEKRGSKLTPLPFLLKAAAA
ALVAEPSFNVSLHHDGESIVHKKYVHIGIAVDTPNGLMVPVIRNVDKKGLWELTDDINAI
VKKARDGKLLPADMQGGCFTISSLGAAGGNGFTPIVNAPEVAILGVSRAQMKPVWNGKEF
VPRNMLPLSLSYDHRAINGADAGRFFTYLTAVVADVRRLLL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtggcaattcaatcaatcaaagtgcccgatattggcggtgcagaaggcgttgaagtaatc
gaaatctccgtcaaggtgggcgatgtagtcgccgagggtgattcgattgtcgtgcttgag
accgacaaagcttcaatggaaattcctgccgatgtcgcgggcaaggttgtcgctattaaa
ataaatgtgggggataaagtatcccagggtgatctgctgattgatgtagaagctgaaggg
gctggcgctgctgccgaaccggcacctgtcgctgcacctgctccggcggcacccgccccc
gctgctgccagcgctgaagtggcggtagttgtacccgacatcggtggcgcggaaggtgtt
gatgttattgaggttaacgtcaatgtcggcgatgaagtttccgcaggtgataccctgatc
gtgttggaaaccgacaaagcctctatggaagttcctgccgaagtcgccggtaaagttgtc
agcctggcaatcaaggtaggcgataaagtatcccagggcagtgctatcggcgtgattgct
acgaccggcgcggcacccaaggcagacgctgccaaagcggaagcgccgaaagcagaggcg
cccaagccagctgctgctccagcacccgttgccgccaaggtagaagaaattgtacaaacc
ggtgatgtatatgcaggccccgccgtgcgcaaactggctcgccaactgggcgtggatctg
ggcaaggtcagcggtacgggcccccgcggtcgcttgctgaaagatgatgtacgcacttac
gttaagcctatcgtacaggctgcacaatcgggtgctgcagttggtggtgcaggtattcct
cgtgtgccggcggtggacttcgccaagtttggtgaaattgaaacggtgaaaatgtccaag
gtgaagaaaatcactgccgacaatatgacccgtaactggctcaatatcccccatgttacc
caatgggatgatgcggatatcaccgaccttgaagccttccgcaatagcctcaaggccgaa
gccgaaaaacgcggtagcaaactgacccccctgccattcctgttgaaagccgctgccgct
gcgctggttgccgagccaagttttaatgtgtctttacatcacgatggcgaaagtattgtg
cataagaagtatgtgcacattggtattgccgtagacacgcccaatggtttgatggtgcct
gtcattcgcaacgttgataagaaaggcctgtgggaactgactgacgacatcaacgctatc
gtgaaaaaagcgcgcgatggcaaactgctgccggccgatatgcaaggtggctgcttcact
atttccagcctgggggctgccggtggtaatggtttcacgcctatcgtgaacgcaccggaa
gtggctatcctcggtgtgtcgcgcgcgcaaatgaaacccgtctggaatggcaaggagttt
gtgccgcgcaatatgttgccgctgtcactctcctacgatcaccgcgccattaatggcgct
gatgcgggccgtttcttcacttacctgaccgcggtagtcgctgatgtaagacgcttgctg
ttgtaa

DBGET integrated database retrieval system