KEGG   Cellvibrio japonicus: CJA_1403Help
Entry
CJA_1403          CDS       T00721                                 

Definition
alkaline phosphatase III (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cja  Cellvibrio japonicus
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cja00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:cja02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1638287..1639636
Genome map
AA seq 449 aa AA seqDB search
MFSAGSLYRSLGLFGALFAQSAGVAAAPVSIIFVIGDGMGPSYTTAYRYFADDPATADIE
TSVFDELLVGMARTYPGDSTLVTDSAAAATALSTGVKTRNGAIGVDEHHKPVQTLLEAAK
ARGYQTAMVATSPITHATPGSFAAHVGHRSENNEIADQYFDQRIDGRFKLDLLLGGGRQY
FERKDRNLVKEFRKHGYAFAGDWQQRHKLKRLPALGLFAPEGMPSALDSEQPLRLQQMTE
QALDLLGKKPFFLLVEASQIDWCGHANDIACAMAEMRDMDGALRVLKAYVDKHPDTLMVV
TADHGTGGLSIGANGVYDWDVASIRGIKATANRIADQLLAADENWQEIWLQLTGMNLSEA
EQRSLQRWIPHSRLSGEDAPQQHNPAAVKGALVAQVLTLINKRTHTGWTTSGHTGEDVQV
FAYGKGHEHFAGNLNNTDIAKHLFRVFAK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgttttcagcaggttctttgtatcgttccctgggtttattcggcgcattgtttgcccag
tctgcaggcgtcgctgcagcacctgtgagtattatttttgtgattggcgatggcatgggc
ccgagttacaccaccgcctatcgctattttgcggacgatcctgcgacagcggatatagag
accagtgtatttgatgagttattggtgggtatggcacgtacctatccgggcgactcaaca
ttggtaactgattcggccgctgcggcaactgcattgtccaccggagttaaaacccgtaac
ggtgctataggtgtcgatgagcatcacaagccggtgcagacactgttggaggcggccaag
gcccgcggttaccaaacggcgatggtggcaaccagcccgattacccatgcaaccccggga
agttttgccgcccatgtcgggcaccgcagtgaaaacaacgaaatcgcagaccagtatttc
gaccagcgcatagacggccgttttaaattggatctattactggggggcgggcgacaatat
tttgaacgcaaggatcgcaacctggttaaggaattccgcaagcatggttatgcctttgcc
ggcgattggcagcagcgccataaactcaaacgcttaccggccttgggtttatttgcgcct
gaaggtatgccctctgcattggatagcgagcagccactgcgcttgcagcaaatgaccgag
caggcattggacctgttgggtaaaaaacccttttttttattggtagaggcgagccagatt
gattggtgcggccatgccaatgatattgcctgtgctatggccgaaatgcgcgatatggat
ggtgccctgcgtgtcctgaaagcctatgtggacaaacatcctgacaccttaatggtggtg
accgctgaccatggtacaggagggctttctatcggcgccaatggagtttatgactgggat
gtggccagtatccgtggcattaaagccacggccaatcgaattgccgaccaactgttggca
gccgatgaaaactggcaggaaatctggttgcaattgacgggaatgaacttgtccgaggca
gagcaacgctctttgcagcgctggattccccactcgcggctcagcggggaagacgcacct
caacagcataaccctgccgctgttaaaggcgctctggtggcgcaggtattgacgcttatc
aacaagcgtacacacacaggctggaccaccagcggccacaccggagaggatgtacaggtt
tttgcctatggcaaaggccatgagcattttgccggtaatttaaataacaccgacattgct
aaacacctgttcagggtatttgctaaataa

DBGET integrated database retrieval system