KEGG   Cellvibrio japonicus: CJA_1440Help
Entry
CJA_1440          CDS       T00721                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cja  Cellvibrio japonicus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CJA_1440 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CJA_1440 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CJA_1440 (thrC)
Enzymes [BR:cja01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CJA_1440 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1672964..1674361
Genome map
AA seq 465 aa AA seqDB search
MKYISTRGLAPALSFEDVVLTGLAPDGGLYVPETLPQFSKEEIASWAGLSYQELAFKVMQ
PFVAGAVSDAEFKKIIADAYASFRHDAIAPLVQTGHNEWILELFQGPTLAFKDFALQFLG
HLLDHLLKKRNQKVVVMGATSGDTGSAAIEGCRRCDNIDIFILHPHNRVSNVQRRQMTTV
LAPNVFNIALEGNFDDCQNMVKASFGDQSFLPEGRQLVAVNSINWARIMAQIVYYFYAGL
ALGAPHRPVAFSVPTGNFGDIFAGYLAKKMGLPIDQLVIATNSNDILHRCISSNDHSKHQ
LQHTLSPSMDIMVSSNFERMLFDLYNRDGAAIRQLMDDFKSGAMVLHESALVKARELFTS
YGVSDDVTVDVIREVFDRTEYLLDPHTAIGVEAARQTRRRQDIPMVCLATAHPAKFPEAV
RKAGQGEDPALPHHMSDLFEREERYSVLAQELAKVQQFIASHVRP
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatacatcagcacacgtggcctggcgcccgcactgagttttgaagatgttgttctg
acaggactggctcccgatggtggcctttatgtaccggaaaccctgccgcagttctccaaa
gaagaaattgcctcctgggctggtttgtcctaccaggaattggcttttaaggtgatgcag
ccttttgtggccggtgccgtcagcgatgcggagttcaaaaagatcattgcggatgcctat
gccagtttccgccacgacgcgattgcacccctggtgcaaaccggtcacaacgagtggatt
ctggaactgttccaggggccaaccctggcgttcaaggattttgccctgcagttcctcggc
catttgctggatcacctgttgaaaaagcgcaaccagaaagtggtggttatgggcgccacc
tccggtgatacggggtccgccgccattgaaggttgccgccgctgcgacaatatcgatatt
tttatcctgcacccgcacaatcgggtatccaatgtacagcgtcgccagatgactacagtt
ctggcacccaatgtatttaatatcgcgttggaaggtaacttcgacgattgccagaacatg
gtgaaagccagttttggtgaccagtccttcttgcccgaagggcgccagctggtggcggta
aactccatcaactgggcgcgtattatggcgcagatcgtttactacttttacgccggcctg
gcgttgggggcgccccatcgtccggtggctttctcggttcccacaggtaattttggcgat
atttttgccggttacctggccaaaaaaatgggcttacctatagatcaattggtgattgcg
accaacagcaatgacatattgcaccgctgtatcagcagtaacgaccacagcaagcatcag
ttgcagcataccctgtcgcccagtatggacattatggtatcgagtaactttgagcgtatg
ctgttcgatctctacaatcgtgatggtgctgccattcgtcaattgatggatgacttcaaa
tccggcgctatggtgttacatgagtcggcattggtgaaagcgcgcgaactctttaccagc
tatggtgtgagtgatgacgtgacggtcgatgtcatccgcgaggtgtttgatcgcaccgag
tacttactcgatccgcacactgccatcggtgttgaggccgcgcgtcaaacccgtcgccgc
caggatattcccatggtctgcctggcaacggcacatccggccaagttcccggaggctgtg
cgcaaggcgggacagggggaggatcctgcattgccacatcatatgagtgatctgtttgag
cgtgaagagcgttacagcgtattggcgcaagagctggctaaggtgcaacaatttatcgcc
agccacgtgcgcccatag

DBGET integrated database retrieval system