KEGG   Cellvibrio japonicus: CJA_1496Help
Entry
CJA_1496          CDS       T00721                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cja  Cellvibrio japonicus
Pathway
cja00010  Glycolysis / Gluconeogenesis
cja00052  Galactose metabolism
cja00500  Starch and sucrose metabolism
cja00520  Amino sugar and nucleotide sugar metabolism
cja00521  Streptomycin biosynthesis
cja01100  Metabolic pathways
cja01110  Biosynthesis of secondary metabolites
cja01120  Microbial metabolism in diverse environments
cja01130  Biosynthesis of antibiotics
cja01200  Carbon metabolism
Module
cja_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJA_1496 (glk)
   00052 Galactose metabolism
    CJA_1496 (glk)
   00500 Starch and sucrose metabolism
    CJA_1496 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CJA_1496 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CJA_1496 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CJA_1496 (glk)
Enzymes [BR:cja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CJA_1496 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACE82860
UniProt: B3PDN6
Position
complement(1730045..1731043)
Genome map
AA seq 332 aa AA seqDB search
MNLLLVADIGGTNARFGLVEFDPAQLKAGGKINYTAQRQITLKCANYSDMATMIKACCAE
LGIAIPAHGCLAIAGPIENGQASMTNLNWKFSINSLRDTLGMETLHVINDFASLAYAVPF
LQDAELITLYAAKSNPDAPIVVMGPGTGFGMAGLIPSGDNWRIVPTEGGHASFAPTNSKE
MRIKSYLLKEQNHVSIENILSGGGLVNLYRALAYNAGIEAETYTPADVSTKGLNNEDPLC
REAVCTFCDVLGEVAGDKALSWGAKGGVVIGGGITPKLASILHDTHFFERYKNKGPMATY
VSDISIRLIVNDKAALVGSAAWLIHNTPALKN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgttattggttgcagatatcggcggtaccaatgcccgtttcggtcttgttgag
tttgatccagcccagctaaaagcgggtggcaagattaactatacagctcaacgacaaatt
accctcaagtgcgccaattattctgatatggccactatgatcaaagcctgttgtgcagaa
ctggggatagccataccagcccacggctgcctggccattgcaggccccattgaaaacggc
caagcgtccatgacgaatttgaattggaagttttcgatcaatagcttgcgcgatactctg
ggcatggaaacactgcatgtcattaatgattttgcatccctcgcctatgccgttcccttc
ctccaggatgcagaactcatcaccctttatgccgccaaatccaacccggatgcccccatt
gtggttatgggcccaggcacaggctttggtatggccggactgattccctccggtgacaac
tggagaatcgttcccaccgaaggcggacatgccagtttcgccccgacaaacagtaaagaa
atgcgaatcaagtcctacctgctgaaagaacaaaaccatgtttccatagaaaatatcctg
tccggcggtggattggttaacctctatcgggcattggcatacaacgcgggcattgaggcc
gagacctacacacccgctgatgtcagcaccaaaggactgaacaatgaagacccgctgtgc
cgtgaagctgtatgtaccttctgcgatgtcctgggcgaggttgcaggagacaaagcctta
tcctggggcgccaagggcggtgtcgttatcggcggaggcattaccccaaaactggccagc
atactgcatgacactcatttttttgagcgctataaaaacaagggtcctatggcaacctat
gtcagtgatatttccattcgcctgattgtgaatgacaaagctgcgctggttggctctgca
gcctggttaatccacaatactcccgccctgaaaaactga

DBGET integrated database retrieval system