KEGG   Cellvibrio japonicus: CJA_1502Help
Entry
CJA_1502          CDS       T00721                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
cja  Cellvibrio japonicus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CJA_1502
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CJA_1502
   00650 Butanoate metabolism
    CJA_1502
  Energy metabolism
   00190 Oxidative phosphorylation
    CJA_1502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1737817..1738188
Genome map
AA seq 123 aa AA seqDB search
MVTSVTSFGRSGLYDWLIQRVGGVIMAAYTIFIVAYLVLNPELTYEQWQSLYSQLWMRVF
SLAVLLSFISHAWIGLWAVLTDYLTVRLLGSKATFLRIFAQIVLGAVAVTYLVWGVQVIW
GIN
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggtaacttcagtcacaagttttggccgtagcggtctttatgactggttaatccagcgt
gttggcggcgttatcatggccgcatataccatctttattgttgcttatctggtcttgaat
cccgaactcacctatgagcagtggcagtcactttatagccagttgtggatgcgcgtcttc
agccttgctgttcttctttcctttatatcccatgcctggattggcctctgggcagtactg
acggattatttaacggttcgcctgttaggctccaaagccaccttcctgcgtatatttgcg
cagatcgtcctgggggctgtagcagtcacctatctggtctggggtgttcaagtaatttgg
ggtattaactaa

DBGET integrated database retrieval system