KEGG   Cellvibrio japonicus: CJA_1508Help
Entry
CJA_1508          CDS       T00721                                 

Gene name
sucC
Definition
succinyl-CoA synthetase beta chain (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cja  Cellvibrio japonicus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CJA_1508 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CJA_1508 (sucC)
   00640 Propanoate metabolism
    CJA_1508 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CJA_1508 (sucC)
Enzymes [BR:cja01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CJA_1508 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1746583..1747794
Genome map
AA seq 403 aa AA seqDB search
MIKETCSTIVKWNYTMNLHEYQGKQLFAQYGLPVSKGIAAATVEEAVAAADQIGGDMFVV
KAQVHAGGRGKAGGVKLVKSKDEIKAFAEKWLGQRLVTYQTDEKGQPVSRILVETCTDIA
KELYLGAVVDRSSRRIVFMASTEGGVEIEKVAHETPEKILKATIDPLVGAQPYQGRELAF
KLGLEGKQINQFVNIFVNLAKLFKEKDLALVEVNPLVITPEGNLHCLDAKLVVDSNSIYR
HPELKAMQDPSQEDPREAHAASWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGQPAN
FLDVGGGATKERVVEAFKIILSDDAVKAVFINIFGGIVRCDMIAEGVIGAVKEVGVKVPV
VVRLQGNNAELGAKVLSESGLNIIADTDLTGAAQKVVAAAANA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaaagagacatgttcaaccatcgtcaaatggaactacaccatgaatttgcacgag
tatcagggtaagcaactgtttgcccaatatggcttgcctgtttccaagggcattgccgct
gcaactgttgaagaagccgttgcagctgcggatcagattggcggcgatatgttcgtcgtt
aaagcacaggttcacgcgggtggccgtggtaaagcgggtggcgtaaagctggttaagagc
aaagatgaaatcaaagccttcgccgaaaaatggctgggccagcgtttggtgacttaccag
acagacgaaaaaggccagcctgttagccgcattctggtggaaacctgtactgatatcgcc
aaagagctgtatttgggtgcagttgtggatcgctcttcacgtcgtatcgtgtttatggca
tctaccgaaggtggtgtggaaatcgaaaaagttgcccacgaaaccccggaaaaaatcctt
aaagccactatcgatccattggtcggtgcacagccataccagggccgtgagctggcattc
aaactgggtctggaaggcaagcagatcaaccagtttgtgaacattttcgtcaacctggcc
aagctgttcaaagagaaagacctggcgctggtggaagtaaacccgctggttattaccccc
gaaggcaacctgcactgcctggatgccaaactggttgtggacagcaactctatctatcgt
caccccgaactcaaggccatgcaggatccttcccaggaagacccgcgcgaagcacacgcg
gcctcctgggagctgaactatgtcgccctggatggcaatatcggctgtatggtgaacggt
gccggtctggcaatgggtaccatggacatcgttaaactgcacggcggccagccagccaac
ttcctcgacgtaggtggtggtgcgaccaaagagcgtgtggttgaagcgttcaaaatcatc
ctgtctgacgatgcggtaaaagccgtattcatcaatatctttggcggtattgtgcgctgc
gacatgatcgctgaaggcgtgattggtgccgtgaaagaagttggtgtgaaagtacctgtg
gttgttcgtttgcaaggcaacaatgccgagctgggcgccaaagtgctgtcagaaagcggc
ctgaacatcattgctgacaccgacctgactggcgctgcccagaaagtggttgctgcagcg
gctaacgcataa

DBGET integrated database retrieval system