KEGG   Cellvibrio japonicus: CJA_1528Help
Entry
CJA_1528          CDS       T00721                                 

Gene name
nahO
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
cja  Cellvibrio japonicus
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CJA_1528 (nahO)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CJA_1528 (nahO)
   00650 Butanoate metabolism
    CJA_1528 (nahO)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    CJA_1528 (nahO)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CJA_1528 (nahO)
   00622 Xylene degradation
    CJA_1528 (nahO)
   00621 Dioxin degradation
    CJA_1528 (nahO)
Enzymes [BR:cja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CJA_1528 (nahO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1772441..1773454
Genome map
AA seq 337 aa AA seqDB search
MQFIKDWLGVGSRSVSLTGSDKASTEQPRIRVGILGTGKIGADLLVKVRRSPWFSCVLFA
GRNLDSDGMRYAASLGVPVSDKGINAFYDPCYTCDLVFDATSAACHLEHAQVFEKLGIFA
IDMTPSQIGELCVPALGMVDHRRHHNISMISCGGQASTPIAQVLYQQISQVRKIAVKSIV
SANSIGPGTLANINEYYCNTRAGLRQYTGDIALDVDLIADAVNLRTPMLTSITASAEHVD
LGRLREPLAVMVERVQRYVPGYRLIDEPTLTDDGVRVDLCVEGLGDYLPAYAGNLDIINC
AALAVAEDYARYAIRSRQYRPYLPEAAATSLAVHLSR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcattaaagattggttaggtgtaggttcacgatccgtatcccttactggttca
gataaggcgtctacggaacagccgcgtatacgggttgggattttaggtacagggaagatt
ggtgctgacttgttagtcaaggttcgccgctccccatggttcagttgtgtattgtttgcc
ggtcgtaatctggattcggatggtatgcgttatgccgcttccctgggcgtcccggtgtcc
gataaagggattaatgccttttatgatccgtgctacacctgtgacctggtatttgatgcc
acctccgctgcctgccatttggagcatgcacaggtgtttgagaagctggggatcttcgcc
atcgatatgacgccttcgcagattggtgagttgtgcgttcccgccctgggaatggttgac
catcgccgacatcacaatatcagtatgatttcttgcggagggcaggcatccacacctatt
gcgcaggtgttataccagcagatttcccaggttcgtaaaattgcggtgaagtctattgta
tctgccaattccatcggccccggaaccctggctaatatcaacgagtattactgcaatacc
cgcgcaggtttgcgccagtacacgggcgatatcgcgttggatgtggatttaatcgcggat
gcggtaaacctgcgcacccctatgttgaccagtattacggcctcagccgagcatgtggat
ctggggcgattgcgtgagcctctggctgtgatggttgaacgggttcagcgttatgttcct
ggttatcgactaatagatgagcctacccttaccgacgatggcgtgcgcgtggatttgtgc
gtagaggggttgggcgattatcttcccgcctatgcgggtaatctggatattattaattgt
gctgcattggcagtggccgaagactatgcccgctatgccatccgctcccgccaatatagg
ccttatttaccggaggcagcggcaacatccctggctgtacaccttagtcgttga

DBGET integrated database retrieval system