KEGG   Cellvibrio japonicus: CJA_1633Help
Entry
CJA_1633          CDS       T00721                                 

Gene name
cel9B
Definition
endo-1,4-beta glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cja  Cellvibrio japonicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cja00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1894665..1896545
Genome map
AA seq 626 aa AA seqDB search
MPVAKTVACWRTCLFVKAYSLLSKPCSIFSLALLPLLVAGCGSGGGTAKPVTGSSSTSSV
VSSPASSAASSSVVNLGLIKLNQVGFLPAASKLAVVPEVAATAFQLLDSDTHRVVYSGEL
TSAANWVPAQERVKLADFSGITEPGIYQLRVEGVEDSHSFPIGTEVYRDLAAASIKAFYY
NRAGTALLSQHAGIYARQAGHPDTQVYVHGSAASQARPEGTVISSPKGWYDAGDYNKYIV
NSGISTYTLLAAYEHFPLLFNEQNLNIPESNDDMPDLLDEILWNLEWMLTMQDPHDGGVY
HKLTNKNFDGTVMPHQATSQRYVVQKTTAAALDFAAVMATASRVFAAYEAQRPGLAAQMR
EAAESAWAWAQTNPAVFYVQPADIRTGEYGDRSLADEFAWAAAELYITTGDDSYYTAMNA
AGTENTVSSWGDVRGLAWISLAHHRDNLTDLADQDLIASRVTGLANSLHNTWQASAYRVS
MQTNHFVWGSNSVALNQGIVLVQAYRLSGERRYLDAAQSMLDYVLGRNATNIAQVTGFGT
RSTLHPHHRPSEADGIEAPIPGFVAGGPNPGQQDRSDCPVSYPSAVTARSYLDHYCSYAS
NEIAINWNAPLVYLVAAVQALTPVNP
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcgcaaaaactgtcgcctgctggcgtacctgtctatttgtaaaagcctattcg
ctattgagcaaaccctgttcgatcttctccctggcgttgttgcccttgttggttgcaggt
tgtggcagcggtggtggaaccgcaaaaccggttactggctcttcgtctaccagctcggta
gtctcaagtcctgcatccagtgcggctagcagttctgtcgttaacctgggcctgatcaag
ctgaaccaggtgggatttcttccggcagcatccaaactggccgtggttcctgaggtggca
gcaacggcgttccaattattggatagcgatacgcacagggttgtgtatagcggggagtta
acttcggcagccaattgggtacctgcgcaagagcgggtaaaactggctgatttttccggt
attaccgagccgggcatatatcagttacgcgtggagggggtggaagattcccattccttc
ccgatagggactgaggtctacagggatttggcggcagccagtatcaaagcgttctattac
aaccgtgccggcaccgccctgttaagtcagcatgcgggtatatatgcgcgccaggctgga
cacccggatacccaggtgtatgtacatggctcggcggccagccaggcgcggcctgagggt
acggtgatttccagccccaagggctggtatgacgcgggtgactacaacaaatatatcgtc
aactctggcatatctacttacaccttgctggcggcttacgagcattttccgctgttattc
aatgagcagaacttgaatattcccgagagcaacgacgatatgcccgatctgctggatgag
atcctgtggaatcttgagtggatgctcaccatgcaggatccgcatgatggtggtgtctac
cataagctcaccaataagaactttgacggtacggtgatgccccatcaggctaccagccag
cgttatgtcgtccagaaaaccacggcggcggcactggattttgcggcagtcatggcgacg
gcaagccgtgtgtttgctgcctatgaagcacaacgccccggcctggctgcacagatgcgt
gaagccgctgaatctgcctgggcctgggcacaaaccaatccggcggtcttttatgttcag
cctgcagatatccgcaccggggaatatggcgatcgcagcctggcggatgagtttgcctgg
gcggcagcggagctctatatcactaccggggacgatagctattacacggcgatgaatgca
gccgggacggaaaataccgtatcttcctggggggatgtgcgtggtttggcctggatatca
ctggcgcatcaccgcgataacctgaccgaccttgccgatcaggatttgatcgcaagcaga
gtgactggcctggcgaatagcctgcacaatacatggcaggcttctgcctaccgggtaagc
atgcagaccaatcactttgtatggggcagcaattctgttgcgcttaatcagggaattgtg
ctggttcaggcctatcgcctgagcggtgagcggcgctatctggatgcggcccagtccatg
ctcgattacgtgcttgggcgcaacgctaccaatattgcccaggtaaccggatttggcacc
cgctcaaccttgcacccacaccatcgcccttcggaggctgatggcattgaggctccgatt
cccggttttgtcgcaggcgggcctaacccggggcaacaggataggagtgactgcccggta
tcttatccctccgccgtgacagccaggtcctacctggatcattactgcagctatgccagt
aacgaaattgccattaactggaatgcacccctggtatacctggttgcggctgtccaggcg
ctgacgccagtcaatccataa

DBGET integrated database retrieval system