KEGG   Cellvibrio japonicus: CJA_1752Help
Entry
CJA_1752          CDS       T00721                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cja  Cellvibrio japonicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CJA_1752 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CJA_1752 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CJA_1752 (trpA)
Enzymes [BR:cja01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CJA_1752 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2012599..2013408
Genome map
AA seq 269 aa AA seqDB search
MSRISQQLTHANAAGKKVLVAYIVNGDPYPEATLPAMHALVANGVDVIELGVPFSDPMAE
GPVIQRGHERALAHHISLTSTLDIVRQFRQTNGTTPVVLMGYANPVERFGYQAFARAAAE
AGVDGLLTVDLPPEEVGVLKQALDEVNLDNIFLLAPTTTVERAHKIASHASGFLYYVSLK
GVTGAGHLDVEAVKAKLAEFGRLTDLPVCVGFGIKDASTAKAVAQLADGVVVGSVLVDKM
GAMADQPAAQIADSLGDLLSEMRQALDSL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaatttcccaacagctgacccacgccaacgcggcgggtaaaaaagttctggtt
gcctatattgtgaatggcgacccctatcccgaggcgaccctgcctgccatgcatgccctg
gtggctaatggcgtggacgtgattgaattgggcgttcccttctccgaccctatggcggag
gggccggttatccagcgcggccatgagcgtgcactggcgcatcacatcagccttacaagc
acgctggatattgtgcgccagtttcgccagaccaatggcactacgccagtggtgctgatg
ggttatgccaacccggttgagcgttttggctatcaggcatttgccagggcggcggccgag
gcgggtgttgatggcctccttacagtggatttgcccccggaagaggtgggcgtcctcaaa
caggctctggatgaggttaacctggacaatattttcctgttggctccgaccacaacagta
gagcgcgcgcataagattgccagccacgccagcggtttcctctattacgtgtcactgaaa
ggggtcactggtgccggtcacctggatgtcgaggcggttaaggctaaactggcagaattt
ggtcgtttaaccgatttgccggtctgtgttggatttggtatcaaagatgcctctaccgcc
aaagcggttgctcaactggccgatggtgtggtggtgggcagtgtattggttgataaaatg
ggcgccatggccgatcagccggcagcacaaatagcagactccctcggcgacttgctgagc
gagatgcgccaggcgctggatagcctctag

DBGET integrated database retrieval system