KEGG   Cellvibrio japonicus: CJA_1882Help
Entry
CJA_1882          CDS       T00721                                 

Gene name
mal77Q
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cja  Cellvibrio japonicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CJA_1882 (mal77Q)
Enzymes [BR:cja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CJA_1882 (mal77Q)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2188201..2189736)
Genome map
AA seq 511 aa AA seqDB search
MSSTQAQVSFFSQRRAGVLLHPTSLPCSESRYLEGTTAFGTLGKEAYRFIDFMAEAGLSV
WQMLPTGPTHQDLSPYQSISAHAGNPDLISFDWLIEQGWIPAESVHLFSPDRTNLAIARQ
QAGASFFAFIQTEYGASVAQTYHAFCAAQAYWLDDVSLFCALRNHFQQQSWTTWPEGLRQ
HDQQALSAARQELAPEVAQVCFEQFAFFQQWQSLRNYAQKKSIYLFGDIPIFVAHDSADV
WAEQGSFLLDEAGQPMSVAGVPPDYFSETGQHWGNPHYDWDVMRADNFRWWLARLKTQLE
LFDLIRIDHFRGFEAYWSIPGDTQDARQGEWIKAPGEALLNACFAAYPDLPLVAENLGVI
TDEVEALRKQFALPGMLVLQFAFDGNPANPHLPHNHSLADVIYSGTHDNDTSLGWYASLN
DFSRQQLRSYCFHSSDAMPWLLINLALSSVGRMAIIPMQDFMELDGRHRMNMPGTTDKNW
VWTFDWDQVDPGLATRIRQQLATYHRLVNQV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcacccaggctcaggtcagttttttttcacaacgtcgcgccggagtgctcctg
catccaacatccctgccatgcagtgaatcccgttacctggaaggaaccactgcctttggc
accctgggaaaagaagcttatcgttttatcgactttatggccgaagcaggtttaagtgta
tggcagatgctacctactggtcccacacatcaggatttgtcgccttatcaatcgatttct
gcccacgcaggtaacccggatttaatcagttttgactggttgatagagcagggctggatt
ccagcagaatctgttcatctcttttctcctgatcgcactaacctggctatagcccgtcaa
caagctggcgccagtttttttgcgtttattcagacggaatacggtgctagcgtcgcacaa
acctatcatgctttttgcgcagcccaggcttattggctcgatgatgtcagcctgttctgt
gccttgcgcaaccatttccagcaacaaagctggaccacctggccggaagggttacgtcag
cacgatcaacaggcgttgtctgccgcccgccaggagctggcgccagaggttgcccaggtc
tgttttgagcaatttgctttctttcagcaatggcagtcattgcgcaattatgcgcagaaa
aaatccatttacctgttcggagatattcctatttttgttgcacacgacagtgcggatgtc
tgggcggagcagggcagtttcctgctggatgaagcagggcaacccatgagtgttgcaggt
gttccaccggattatttttcggaaacaggccaacattggggcaacccccattatgattgg
gacgtaatgcgcgccgataattttcgctggtggctcgcgcgcctgaaaactcaactagaa
ttatttgacctgatccggattgatcattttcgtggttttgaagcctattggtcgattcca
ggcgatacccaggacgctcgccagggagagtggatcaaggcaccgggagaagccttgctt
aacgcctgctttgcagcatacccggatctgcctctggtagctgagaacctgggcgttatt
accgacgaggttgaagcattgcgcaagcaatttgccctgccgggcatgctggtactgcag
tttgcctttgatggcaaccctgccaatccccatctgccgcacaatcattccctggcggat
gtgatttacagcggaacgcatgacaacgataccagtctgggttggtatgcgtcgttaaac
gatttttcgcgacaacaattgcgcagttattgttttcactcaagcgatgcaatgccctgg
ttattaataaacctggcattatcatcggttggtcgcatggctattattcccatgcaagat
tttatggagctggatggacggcacaggatgaacatgccggggacaacggataaaaattgg
gtgtggacgtttgattgggatcaagttgatccagggttggcgactcggatccgccaacaa
ttagcaacctatcatcgcctggttaaccaggtgtga

DBGET integrated database retrieval system