KEGG   Cellvibrio japonicus: CJA_1885Help
Entry
CJA_1885          CDS       T00721                                 

Gene name
gbe13A
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cja  Cellvibrio japonicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CJA_1885 (gbe13A)
Enzymes [BR:cja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CJA_1885 (gbe13A)
Exosome [BR:cja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CJA_1885 (gbe13A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2193152..2195365
Genome map
AA seq 737 aa AA seqDB search
MSNPKQEQHLSQDLLRIITATHHDPFEVLGRHSLPVPTATADTLVRVYLPGARSAELVIN
RQNRQIAPLNRLPGTDFFEWYGLGQQLPVHYQIEWYDRHNQHRVHYDPYAFAPQLGELDM
HLFAEGQHWNIYNLLGAHPRQVDGINGVLFATWAPNAERISVVGNFNDWDGRHHPMRVRG
SSGLWELFIPGVQPGDLYKFEIRNRQTGAVFLKSDPYGQSFEHRPSTSSIITADSAFAWQ
DADWMEHRAHWDWQASPLSIYEVHLGSWRRGWAGEFLSYRELAHQLADYVKYMGFTHVEI
LPVSEHPLDDSWGYQTTGYYAPTSRFGSPDDFRYFVDHLHQQGIGIILDWVPAHFPKDAH
ALARFDGSALYEHEDPRLGEHRDWGTLIYNYGRSEVRNFLLANALFWLKEYHIDGLRVDA
VASMLHLDYSRQPGEWIPNIHGGNENLEAMTFLQQLNAICHGQHSGALVIAEESTAWPQV
TRPTWVGGLGFSMKWNMGWMHDTLEYMSREPVHRQYHHNQLTFGMMYAFTENFQLPFSHD
EVVHGKGSMINKMPGDDWQKFANLRLLYTYLYTYPGSKLLFMGGEFAQWSEWAHGRSLDW
HLLDYGPHQGVQSAVKDLNHLYRQVPSLYQRNFRGDGFEWIDCHDSTQSIISYIRSSDSE
FTLVILNFTPVPRYNYRIGVPVAGQYQEVFNSDSQFYGGSNLGNANPLYTQPVPWMNHGQ
SLEVTLPPLGGLLLKLA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcccaagcaagaacaacacttaagtcaagatttgctacgtattattactgca
acacaccacgatccctttgaggttttgggtagacactccctccccgttccaactgcaacc
gccgacaccctggttcgggtttacctgccaggcgcacgttcagccgagctggtaattaac
agacaaaacagacaaattgccccattgaaccgccttccgggaactgatttctttgagtgg
tacggtttggggcagcagcttcccgtccactatcaaattgaatggtacgaccgccacaac
caacaccgggttcattatgatccctacgcctttgcaccacaattgggcgaactggatatg
cacctgttcgctgaaggtcaacattggaacatttacaatcttttgggtgcacaccctcgc
caggtggatggcatcaatggggtgctttttgccacctgggcccccaatgccgagcgaatc
agcgtcgttggcaatttcaacgattgggatggccgtcaccatcccatgcgtgtgcgcggt
agcagcggtttgtgggaattatttatcccgggtgttcagccgggcgacctgtataagttt
gaaatccgcaaccgccagacaggtgcggtattcctgaagtcagacccctatggccagtcc
ttcgaacatcgtcccagtaccagctccatcattacagccgattcagcatttgcctggcag
gacgcggactggatggaacatcgtgcccactgggattggcaggcctctcccctctctata
tatgaggtgcatttggggtcctggcgccgcggttgggccggtgagtttttaagttatcgc
gagctggcccaccagctggcggattatgtgaaatacatgggctttacccatgttgaaata
ctgccggtcagcgagcatccgctggacgattcctggggataccagaccacgggctactat
gcgcctaccagtcgctttggttcacccgatgacttccgttatttcgtagatcacctgcac
cagcagggtatcggcattatcctcgattgggtgcccgcccactttcccaaagacgcccat
gccctggcgcgctttgatggttcagcactttatgagcatgaagacccacgcttgggcgag
cacagggactggggcaccttgatctacaactatggccgcagtgaggtgcgtaacttcctg
ctggccaatgccctgttttggttaaaggaatatcacattgatggcctgcgggtagatgcg
gtcgcatccatgctgcacctggattattcccgccaaccgggcgagtggattcccaatatc
cacggcggtaatgaaaacctggaggccatgaccttcctgcaacaactaaacgcgatctgc
catggccagcattccggtgccctggtgatcgccgaagaatccaccgcctggccacaagtc
acccgtcctacctgggttggcggcctgggtttctcgatgaaatggaatatgggctggatg
cacgacaccctggagtatatgagtagggagccagtccaccgccagtatcaccataaccaa
ttaaccttcggcatgatgtacgcctttaccgagaacttccaactgccgttttcccacgat
gaagtggtgcatggcaaaggcagcatgattaacaaaatgccgggagacgattggcagaag
tttgccaacttgcgcctgctctatacctacttgtatacctatcccggcagcaaactactg
tttatggggggcgaatttgcccaatggagcgaatgggcccatgggcgctcactcgattgg
cacctgctcgattacggcccacaccagggtgtgcaatcggcggtgaaggacctcaaccat
ttgtaccggcaggttccatcgctctaccaacgcaattttcgcggcgatggttttgaatgg
attgattgccatgacagtacccaatccatcatcagttatattcgttccagcgatagcgag
ttcaccctggttatcctgaattttacgccggtgccccgttacaactaccgtataggtgtg
cctgtggccgggcaataccaggaagtgttcaattctgactcccagttttatggaggtagc
aacctgggtaatgccaacccgctctacacccagcctgtgccctggatgaaccacggccag
tcgctggaagtgaccctgccgccacttgggggcctgttgctcaaactcgcctga

DBGET integrated database retrieval system