KEGG   Cellvibrio japonicus: CJA_1982Help
Entry
CJA_1982          CDS       T00721                                 

Definition
(GenBank) aldose 1-epimerase family protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cja  Cellvibrio japonicus
Pathway
cja00010  Glycolysis / Gluconeogenesis
cja01100  Metabolic pathways
cja01110  Biosynthesis of secondary metabolites
cja01120  Microbial metabolism in diverse environments
cja01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJA_1982
Enzymes [BR:cja01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CJA_1982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACE84084
UniProt: B3PHI2
Position
2298176..2299105
Genome map
AA seq 309 aa AA seqDB search
MHINSLDPQAIQQLDNLIAKCDFLQLRTSNDVYPQAPGSGLPLICVETPLCSAVISLQGA
HLLEYKTTEGDPLLWVSPNCDFSPGAALRGGVPLCLPWFGVNREDPNKPKHGFARNNFWQ
LADARMLADGSVELEFLFVSEGHLLFAYDFSAELRMTLGQSAKLELTINNTDDEDFDCSW
AMHNYYPVHQLAEVRVEGLGGRTYKDNLEGYAEKLQAGDVRFQEPVDRVFPGIDNSLKII
GSPSIAITQHNCPSVITWNPGDEAAANIADIGAGQEQFYICVERGAVLDEQWHLPAGSSK
SAWMEFKQV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcaacagcctcgatccgcaagccatccagcaactcgataacctcatcgccaaa
tgcgattttctccagttgcgcaccagcaatgatgtctatccccaggcccccggtagtggc
ttacccctgatctgtgttgaaaccccgctctgctctgccgttatctcactccagggagcc
catctgctcgaatacaaaaccactgagggcgatcccctgttatgggtcagccccaactgc
gactttagccccggcgcagcgctgcgcggtggcgttcccctgtgcctgccctggtttggc
gttaatcgcgaagatcccaacaaacccaagcatggtttcgcgcgtaacaatttctggcaa
ctggccgacgcccgcatgctggcggatggcagtgtggaactggagttcctgtttgtcagt
gaggggcatttgttgtttgcctatgatttctctgccgaactgcgcatgaccttaggccag
agtgcaaaattggaactcaccattaataataccgatgacgaagatttcgattgcagttgg
gctatgcacaactactaccccgtacaccagcttgccgaagttcgtgtggagggactgggc
ggccgaacctataaggacaacctggaaggctatgccgaaaagctacaagctggcgatgtc
cgctttcaggagccggtagacagggtcttcccaggcatcgacaactcactcaagattatc
ggttccccgtcgattgcaatcacccagcataattgccccagcgtcattacctggaaccca
ggcgatgaagcggcggcaaacattgcggacattggcgcaggacaggaacagttttatatc
tgcgtggagcgcggcgcggtattggatgagcaatggcacctgcctgccggcagcagcaaa
agcgcgtggatggagttcaaacaggtttaa

DBGET integrated database retrieval system