KEGG   Cellvibrio japonicus: CJA_2116Help
Entry
CJA_2116          CDS       T00721                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cja  Cellvibrio japonicus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CJA_2116 (galU)
   00052 Galactose metabolism
    CJA_2116 (galU)
   00500 Starch and sucrose metabolism
    CJA_2116 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CJA_2116 (galU)
Enzymes [BR:cja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CJA_2116 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2445849..2446736)
Genome map
AA seq 295 aa AA seqDB search
MSIKKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVIEEAAAAGIKEIVLVTHASK
NAIENHFDTSFELEAQLEARLKRSLLAEVRSITPPGLTVISVRQAEAKGLGHAILCARPV
VGDEPFAVLLPDVLIDNAEANLKQHNLAGMVARFNETGHSQTLVEEVPHDQVDKYGVVDC
SGVTIPAGKTAPVKAMVEKPPIDEAPSNMAIVGRYVLSKTTWDLLAKTLPGAGGEIQLTD
ALDALIQLETIEAYQLVGRSHDCGSKLGYLKAIVTYGARHPDVGPAFSAFLQESR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtcaataaaaaaagcggtgattcctgttgctggtttgggtacgcgcatgttacccgct
accaaggcaattcccaaagaaatgttgccggtagttgataagccgctgattcaatatgtt
attgaagaagcagccgcagcaggtattaaggagatcgtgctggtaacgcatgccagtaaa
aatgctattgaaaaccattttgataccagcttcgagttggaagcccagcttgaagcgcgt
ttgaagcgctcgctgctggcggaggtgcgctcaatcactccacctgggttaaccgtgatt
tcggtgcgtcaagcggaagcaaaaggtttggggcatgcaattctttgcgcacgtccggtt
gtaggtgatgaaccgtttgccgtactgctgcccgatgtgttgattgataatgccgaggct
aatctcaaacagcacaatctggccggtatggtggcgcgttttaatgaaacgggtcacagc
caaaccctggttgaagaggtcccccatgaccaggtggataaatacggtgttgttgattgc
tccggagtcactattcccgccggtaaaacagcgcctgttaaggccatggtcgagaagcca
ccgatcgatgaagcaccatccaatatggcgattgtggggcgttatgtactatcaaaaacc
acctgggatttattggccaaaaccctgccgggcgcaggcggggaaattcagctgaccgat
gccctggatgcgctgatacaacttgaaactattgaagcctatcaactggttggtcgcagt
catgattgcggctccaagctgggatacctgaaagccatagtaacctatggcgctcgccat
cccgatgtggggcctgctttttcagcatttttgcaggaatctcgctag

DBGET integrated database retrieval system