KEGG   Cellvibrio japonicus: CJA_2137Help
Entry
CJA_2137          CDS       T00721                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cja  Cellvibrio japonicus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cja00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CJA_2137 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CJA_2137 (cheB)
Enzymes [BR:cja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CJA_2137 (cheB)
Two-component system [BR:cja02022]
 CheA family
  CheA-CheYBV
   CJA_2137 (cheB)
Bacterial motility proteins [BR:cja02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CJA_2137 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2466291..2467448)
Genome map
AA seq 385 aa AA seqDB search
MPVRVLVVDDSNFFQHRLKEIINEHPDLKVIGIASNGREAVDKAAELKPDIITMDFEMPV
MDGVTAIRHIMAHRKVPILMFSSLTYEGAKVTLDALAAGALDFIPKDFAEVSRNSAALKQ
KLHERLLTLAGSSVRLPSTDYTTDTKAPVMAPTPSATSAATSALARSTSISSAGSGYSHH
SSVSAKPGVNDSYRLKRQPKILVIGASTGGPVALGEVLTTLPANFPLPIVLVQHMPENFT
KAFAERLNKQCHIRVREAIEGDLLEPGLALLAPGGKQLMLDKRNNGCVRILADDDRINYK
PSLDITFGSAANAFGDKVLGVVLTGMGSDGCQGARLLKESGSAIWSQDEASCVIYGMPMA
VAKAGLTDKVLSLKEIGPRLVREVM
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcagggtattagttgttgatgattccaatttttttcagcatcgcctgaaagaa
ataattaatgagcatcccgacctgaaggtgattggtatcgccagtaatggccgcgaagcc
gtggataaggcagcggaattaaagccggatatcatcactatggatttcgaaatgccggtt
atggatggtgtgacggctatccgccatatcatggcacatcgaaaggtacctattttgatg
ttctcctcgctaacctatgagggggccaaggtaaccctggatgccttggcagcaggtgca
ttggattttattcccaaggattttgcggaggtatcgcggaattctgctgcgctcaagcaa
aaactccatgagcgtttattgaccttggcaggttcttctgtgcgcctgccatcgacggac
tatacaacggatacgaaagcgccggtgatggcgccaacgccatcagcgaccagtgcggcc
acttccgccctggcgcgctctaccagcatttcctcggcgggcagtggttattcgcatcac
tcttccgtttctgcaaaacccggagtaaacgatagctaccgccttaaaaggcagcctaaa
atcctggtaattggcgcatcgaccggtggacctgttgcattgggagaagtgttgaccacc
ttgccggctaatttcccattgcccatcgtattagtgcagcacatgccagaaaactttacc
aaggcatttgcagagcgtttaaacaagcaatgccatatccgtgtgcgcgaggcgatagaa
ggcgatttactggagccgggcttggcattgcttgccccaggcggtaagcaattgatgctg
gataagcgcaacaacggttgtgtcaggattcttgccgacgatgatcgcatcaattacaag
ccctcattggatattaccttcggctcagcagccaatgcctttggcgataaagtgcttggt
gtcgtattgacagggatggggtcagacggctgccaaggggcgcgcttattgaaagagagt
ggttcagcaatctggtcacaggatgaagccagttgtgtgatttacggtatgcccatggcg
gttgccaaggcaggcttgactgacaaggtgttaagcctgaaggaaattggtccacgtctg
gtgcgtgaggtgatgtaa

DBGET integrated database retrieval system