KEGG   Cellvibrio japonicus: CJA_2439Help
Entry
CJA_2439          CDS       T00721                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cja  Cellvibrio japonicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cja00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CJA_2439 (recR)
DNA repair and recombination proteins [BR:cja03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CJA_2439 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2785257..2785850)
Genome map
AA seq 197 aa AA seqDB search
MFSPLIDELMSSLRCLPGVGPKSAQRMALHLLERDRVGAERLARSLHKAIEGVGRCRRCR
TLTEQELCGICRNERRDPGLLCVVETPADVLAIEQAGTYQGKYFVLLGHLSPIDGVGPED
IGIDQLLQLLQQEPVTEVILATNPTVEGEATAFYISERAKNLNVTVSRIAHGVPLGGELE
FIDGGTLAHAFSSRRSL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtttagcccactgattgatgaattaatgtcttcgttgcgctgcttgccgggggttggc
cccaagtcggcccagcgtatggcattgcacttgctggagcgcgaccgcgtcggtgccgag
cgcctggcgcgcagcctgcacaaggccatcgaaggtgtagggcgctgccgccgttgccgc
accctgaccgagcaggagttgtgcggtatttgccgcaatgagcgtcgcgatcccggcttg
ctgtgtgtggtggaaacgcctgcggatgtgctggcgattgaacaggcggggacttaccag
ggcaaatactttgtgctgcttggccacctgtcgccgattgacggtgttgggccggaggat
atcggcatagatcaactgctccagttattgcaacaggagcctgttaccgaggtcatcctg
gcgaccaatcccacggtagaaggtgaggcgaccgcgttttatatcagtgagcgcgctaaa
aacctcaatgtcaccgtgtcgcgtattgcccacggcgtacctctgggcggcgagctggaa
tttatcgacggcggcaccctggcgcacgccttctcatcccgcagaagcttgtaa

DBGET integrated database retrieval system