KEGG   Cellvibrio japonicus: CJA_2715Help
Entry
CJA_2715          CDS       T00721                                 

Definition
putative outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
cja  Cellvibrio japonicus
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJA_2715
   00565 Ether lipid metabolism
    CJA_2715
   00590 Arachidonic acid metabolism
    CJA_2715
   00591 Linoleic acid metabolism
    CJA_2715
   00592 alpha-Linolenic acid metabolism
    CJA_2715
Enzymes [BR:cja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     CJA_2715
    3.1.1.32  phospholipase A1
     CJA_2715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3188746..3189852
Genome map
AA seq 368 aa AA seqDB search
MPRSLPATFYSGYLTHLIALVSLFVSCNLQANEPATPTPVLELTQEEMSQCLSSTVTGAD
ETMTIAQLKEACVKLKELSASSSGDTDGSPAAQPDEKPQGLLDNRFAMEALSRANRFLLT
PHKRNYFLPASYHRRPNDAPYLNTDTSLSELNHTEAEMQLSIKILIRENIFDDNGHLYLG
YTNHAFWQVYSDHDSAPFRETNHEPEFILSFQNDWKILGFRNALNEIAINHQSNGQGKLL
SRSWNRLMLRSVFERGNLVFSLTPWYRLPESKQRYPGDPDGDDNPDILDYMGHFEFNSAY
KHKDNIFSLMLRNNFSTNNTTMELGWSFPLSTNLRGYVRYFEGYGHSLIDYNYRQQVFGL
GIIFTDLF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcccagatcactgcccgcaaccttttactccggatacctgacgcacctgattgcactc
gtttccctctttgtatcctgcaacctgcaagcaaacgaacccgccacaccaacccccgtg
cttgagttaacccaagaggaaatgagccaatgcctctcctcaacggtaaccggagccgac
gaaaccatgaccatcgcccagctcaaagaagcctgcgtcaagttgaaggagctctcagcc
agttcatcgggcgataccgatggctcgccagctgcccaaccggacgaaaaaccccagggg
ttgctcgataaccgttttgccatggaagcgcttagccgcgccaatcgctttttgctgaca
cctcacaaacgcaactattttttaccggccagctatcatcgtcgccctaatgatgcgccc
tatctcaatacggatacatcactctcggaattaaaccataccgaagcggagatgcagctc
agtatcaagatcctgatccgcgaaaacatttttgatgataatggccatctttacctgggc
tataccaaccacgcgttctggcaagtctatagcgaccacgactcagcccccttccgcgag
accaatcacgaaccggaatttatcctgagctttcaaaacgattggaaaattttgggattt
cgcaacgcattgaatgagatagcgattaaccaccaatccaacgggcaggggaaattgcta
tcgcgctcctggaatcggttgatgctgcgctctgtgtttgagcggggtaatcttgtgttt
tcgcttacgccctggtaccgccttccggaaagtaagcagcgctatcccggtgacccggac
ggggatgacaatccggatatcctcgattacatgggtcactttgaattcaacagcgcctac
aaacacaaggataatattttcagcctgatgctgcgcaataacttttccactaacaacacg
accatggagttgggctggagctttccattaagcaccaacctgcgcggctatgtgcgctac
tttgaaggctatggccacagcctgattgattacaactaccgccaacaggtatttgggctg
ggtattatttttaccgacctgttttaa

DBGET integrated database retrieval system