KEGG   Cellvibrio japonicus: CJA_2794Help
Entry
CJA_2794          CDS       T00721                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cja  Cellvibrio japonicus
Pathway
cja00340  Histidine metabolism
cja01100  Metabolic pathways
cja01110  Biosynthesis of secondary metabolites
cja01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    CJA_2794 (hisD)
Enzymes [BR:cja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CJA_2794 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh PTE
Motif
Other DBs
NCBI-ProteinID: ACE85595
UniProt: B3PBM7
Position
complement(3282407..3283777)
Genome map
AA seq 456 aa AA seqDB search
MLSSWLVGLSVGMCKSLFEKYVMSTLVNRLDSRQADFNQRLDQLLAWESVSDARVAGVVG
DILGQVKSRGDAAVLEYTNRFDRRSAQTMADLVVAPEQLHAALDNISPEQRQALQVAAER
IRQYHQHQLQNSWRYTEADGTVLGQQISAMERVGLYVPGGKASYPSSVLMNAIPAKVAGV
DELTMVVPAPDGEISPMVLAAAAIAGVDRVITIGGAQAVAALAYGTETITKVDKIVGPGN
IYVATAKRAVFGQVAIDMIAGPSEILVICDGETDPDWIAMDLFSQAEHDEQAQAILLCPN
ADYLDKVEASIAKLLPTLQRNDIASSSLKNRGALILVKDIADAIALSNRIAPEHLELSVT
DPEALLPQIRHAGAIFMGRHTPEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSII
MCSPAGASELAKTASVLARGEYLEAHARSAEYRIIK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgctttcctcctggcttgttggtttgtcggtaggaatgtgcaaatccctttttgaaaaa
tatgttatgtcgacattagtgaaccgtttagatagccgccaggccgatttcaatcagcgc
cttgaccagttgctggcgtgggagtctgtgagtgatgcacgtgttgccggggttgtgggc
gatattttggggcaggtaaaaagccgtggcgatgccgctgtactggaatacaccaaccgc
ttcgatcgccgcagtgcacaaaccatggccgatctggtcgtcgcccccgagcagctacac
gccgccctggacaatatcagtcctgaacagcgccaggctctgcaagtggctgccgaacgc
attcgccagtatcaccaacaccagctgcagaattcctggcgctacaccgaagccgatggc
actgtgctcggccagcaaatttcggccatggagcgtgtaggcctgtatgttcccggtggc
aaagcctcttacccctcgtcggtattgatgaatgctattcccgccaaggtggcgggtgtg
gatgagctgactatggttgtgcccgcccccgatggtgaaatcagccccatggtgttggcc
gccgccgctattgccggtgtagatcgtgtgattaccattggcggtgcgcaggcggtggcg
gcactggcttacggtacagaaactattactaaggtggataaaattgttggccctggcaat
atttatgtagccacggccaagcgtgcagtcttcggccaagtggctattgatatgatcgct
ggtccctcggaaattttggtgatctgcgacggagaaaccgatccggattggatcgctatg
gatttattcagccaggcggaacacgacgaacaggcccaggcgattttgctctgccccaat
gcggactatctcgataaggtagaggcgtctatcgccaaattgctgcccacattacagcgc
aatgacattgcctcctcctcgctcaaaaatcgcggcgccctgattttggtaaaggatatt
gccgacgctattgcgttgagcaaccgcattgcgccggagcacctggagttgtcggtcacc
gatccggaagcgctgctgccgcagattcgccacgccggcgccatctttatgggacgccac
acgcccgaagccttgggcgactattgtgctggtcccaaccacgtactgcctacctcgggt
accgcacgcttttcatcgcctttaggggtgtacgatttccaaaagcgcagctcgattatc
atgtgctcacccgcaggcgcctcggagcttgccaaaactgcctcggtactggcgcgcggc
gaatacctggaagcgcacgcccgctcggcggaataccgtattatcaagtag

DBGET integrated database retrieval system