KEGG   Cellvibrio japonicus: CJA_2888Help
Entry
CJA_2888          CDS       T00721                                 

Gene name
xyn10D
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cja  Cellvibrio japonicus
Brite
Enzymes [BR:cja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     CJA_2888 (xyn10D)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3387875..3389011
Genome map
AA seq 378 aa AA seqDB search
MQVSRRKLLQLMGASAALVPAVKLQAASAPTATSLKTAYQQDFLIGAALSASIINQADPQ
LVTLIARDFNSITPENCMKWGEIRNADGSWKWADADAFVAFGEQHNLHMVGHTLVWHSQI
PDSVFKNKDGNYISKTALQKKMQEHITTLAGRYKGKLHAWDVVNEAVDDNLKMRESHWYK
ILGEDFIYQAFNLAHEVDPKAHLLYNDYNIERTGKREATIEMIKRLQKRGMPIHGLGIQG
HMGIDTPPIAEVEKSIIEFAKLGLRVHFTELDIDVLPSVWELPVAEISTRFEYKPERDPY
TKGLPQEMQDKLARRYEDLFKLFLKHADKIDRVTLWGVSDDASWLNDFPIRGRTNYPLLF
DRQHEPKPAYFRVLDLKQ
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtatcacgcaggaaactactccagcttatgggtgccagcgccgccctggtgcca
gccgttaaattgcaggccgccagtgccccgactgccactagcctgaaaacagcgtaccaa
caggatttcctgataggtgcagcgctgagtgccagcattattaaccaggcagatccccag
ttagttaccttgattgccagggattttaactccattaccccggaaaactgcatgaagtgg
ggtgagatccgcaacgcagatggcagctggaaatgggccgatgccgatgcatttgtcgcc
tttggcgaacagcataacctgcatatggttggccacaccctggtatggcatagccagatt
cccgactccgtatttaaaaataaagacggtaattacatcagcaaaacagccctgcagaaa
aaaatgcaggagcacatcaccaccctggcaggccgttataaaggcaagctgcacgcctgg
gatgtggtcaacgaagccgtcgacgataacctgaaaatgcgcgagagccactggtacaag
attctcggagaagactttatttaccaggccttcaacctcgcccatgaagtcgatcccaag
gcgcacctgctgtataacgactacaacattgaacgcactggcaagcgcgaggccacgatt
gagatgatcaaacgcttgcaaaaacgcggcatgcccatccatggtttgggcatccagggg
catatggggatagatacgcccccgatcgccgaagtcgaaaaaagtattatcgaatttgcc
aaactcggcttgcgtgttcactttactgaactggatatcgatgtgcttccctcggtatgg
gaattaccggttgccgaaatttccacccgctttgagtacaaaccggagcgcgacccctat
accaaaggcttgccacaagagatgcaggataaactggcgcgccgctacgaagacctgttc
aaactcttcctcaagcacgctgataaaatcgatcgtgttaccctttggggcgtcagtgat
gatgccagttggctgaatgatttcccgattcggggacgcaccaactatccattgttattt
gatcgccagcatgagccaaagcctgcctacttccgtgtactggatttgaaacaataa

DBGET integrated database retrieval system