KEGG   Cellvibrio japonicus: CJA_3066Help
Entry
CJA_3066          CDS       T00721                                 

Gene name
xyn10C
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cja  Cellvibrio japonicus
Brite
Enzymes [BR:cja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     CJA_3066 (xyn10C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3639064..3640884
Genome map
AA seq 606 aa AA seqDB search
MKKIQQLLMLSLISSTLIACGGGGGGGSTPTTSSSPQSSSPASTPSSASSSSIISSSSLS
SSLSSSSLSSSSLSSSSASSVSSSSVAASEGNVVIEVDMANGWRGNASGSTSHSGITYSA
DGVTFAALGDGVGAVFDIARPTTLEDAVIAMVVNVSAEFKASEANLQIFAQLKEDWSKGE
WDCLAASSELTADTDLTLTCTIDEDDDKFNQTARDVQVGIQAKGTPAGTITIKSVTITLA
QEAYSANVDHLRDLAPSDFPIGVAVSNTDSATYNLLTNSREQAVVKKHFNHLTAGNIMKM
SYMQPTEGNFNFTNADAFVDWATENNMTVHGHALVWHSDYQVPNFMKNWAGSAEDFLAAL
DTHITTIVDHYEAKGNLVSWDVVNEAIDDNSPANFRTTDSAFYVKSGNSSVYIERAFQTA
RAADPAVILYYNDYNIEQNNAKTTKMVDMVKDFQARSIPIDGVGFQMHVCMNYPSIANIS
AAMKKVVDLGLLVKITELDVAVNQPHCDAYPANKINPLTEAAQLAQKKRYCDVVKAYLDT
VPVNQRGGISVWGTTDANTWLDGLYREQFEDEKISWPLLFDNNYNDKPALRGFADALIGT
QCTNTH
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatccagcaactcctcatgctctccctgattagctcaacactaattgcctgt
ggcggcggtggagggggcggttcaacaccaaccaccagcagctcaccccaatcctctagt
ccagcatcgacgccatccagtgcttcatcctcatcgatcatatcctcctcatcgctatca
tcatcgctgtcttcctcatcactatcctcgtcatcgctgtcttcttcatcggcgagcagt
gttagcagctccagtgtcgctgccagcgagggcaatgttgttatagaggtggacatggca
aatggctggagaggcaacgcatcaggcagtaccagccattccggtattacctacagtgcc
gatggcgttacctttgccgcactgggtgatggcgtgggcgctgtttttgatattgcccga
ccaaccacactggaagatgctgtgatagcaatggttgttaatgtcagcgctgaatttaag
gccagtgaagccaacttgcagatatttgcccagttaaaagaagactggtcaaagggcgaa
tgggattgtctggcggccagcagcgaactcactgcggatactgacctaaccctgacctgc
accattgatgaagacgacgataaattcaaccaaacggcgcgcgatgtacaagtcggtatc
caggccaagggaacacccgccggaactatcaccattaaaagcgtcaccattacactcgca
caggaagcctattcagccaatgtcgatcacctgcgcgacctggcccccagcgatttcccc
attggcgtcgccgtgtccaataccgactccgccacttacaacctgctcaccaacagcaga
gagcaggctgtggttaaaaagcacttcaatcatttaactgccggtaacatcatgaagatg
agttacatgcaacctaccgagggcaattttaacttcaccaacgccgacgcctttgtggat
tgggccactgaaaataatatgacggtgcacggccacgccctggtatggcattccgattac
caggttcccaactttatgaaaaactgggcaggcagtgcagaagactttttagcggccttg
gacacacatatcaccaccattgtcgatcactacgaagccaagggtaacctcgtcagttgg
gacgtcgttaacgaagccatcgacgacaacagtccggcaaacttccgcacgacggattct
gcgttttatgtgaagagcggaaacagctctgtctatattgagcgcgccttccagaccgcg
cgcgcggcagatcccgctgtgatcctctactacaacgactacaacattgagcagaacaat
gccaagaccaccaaaatggtcgatatggtcaaggacttccaggcgcgcagtatcccgatt
gacggtgtgggcttccagatgcatgtctgtatgaactatccatccatcgccaacatttct
gccgcgatgaagaaagtggtcgaccttggcttgctggtaaaaattaccgaactggatgtt
gccgtcaaccagccccattgcgatgcgtatccggccaacaaaatcaatccgctgaccgaa
gcggcgcaattggcccagaaaaaacgctactgcgacgtagtgaaggcctatctggataca
gtcccggtgaatcagcgcggcggtatcagcgtctggggaactaccgatgccaacacctgg
cttgatggcctgtacagagaacagtttgaggatgaaaaaatttcctggcccttgctgttc
gacaacaactacaacgacaaacctgcactgcgcggttttgccgatgcgttaatcggtacg
caatgtactaatacacattga

DBGET integrated database retrieval system