KEGG   Cellvibrio japonicus: CJA_3249Help
Entry
CJA_3249          CDS       T00721                                 

Gene name
cgl13A
Definition
cyclomaltodextrin glucanotransferase (EC:2.4.1.19)
Orthology
K00701  
cyclomaltodextrin glucanotransferase [EC:2.4.1.19]
Organism
cja  Cellvibrio japonicus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3884395..3886092)
Genome map
AA seq 565 aa AA seqDB search
MYKIMTKKSLLALAALGLLSSCASPPSANRDATNLNAYGTLNPFASEQIYFLLTDRFVDG
DPDNNQVNQGGKYKTFNIPLIGPEGKQANIGYMGGDFKGIINNAQYIKDMGFTALWTTPI
VDNPDEAFSGGEPTKFGSVGTDGGKTGYHGYWGVNFYKVDEHLESPDLAFADFTRILRED
YDLKYVLDIVANHGSPSYSMPVSQASMGKLYDEQGRLVADHQNLYPDKLDPNNPLHKFFN
TQPGLAQLSDINENNPEVLDYFVNSYFKWIDQGAYALRVDTIKEMPHHFWKKVADRIRER
HPDMFMFGESYSYEASFIAQHTRPENGGYSVLDFPGRQAITSVFENDESDYASILSYLHL
KDGMYQNPYELVTFYDNHDMARMNASDRGFVNANNWLFTSRGIPCIYYGSEANFSTGLKE
HEGNRNYFGQARVNAAKNHVVHNNLTRIAHVRKDNVSLQRGLQVNLVFAGNIASFYRIYQ
QDGVNQTALVVLNKGEAAESVTLDKMLNSGQWRDALSGKKLQVSKKQKSLTLDVPANGVR
VLLLDAPITNPDLIAEVKHSMAALF
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaataatgacgaaaaaatcactattggcactggccgctctggggcttttatca
agttgcgcatcacccccttctgcgaatagggacgcgacaaacctcaacgcctatggaaca
ctcaacccttttgccagcgaacaaatttattttttgctgacagatcgctttgttgatggc
gaccctgataataaccaggtcaaccagggtgggaaatataaaacctttaatattccgctg
atcggaccggaaggtaagcaggccaatattggctatatgggtggagacttcaaaggtatt
atcaataatgcccaatatattaaagatatgggctttaccgcgctgtggactacgccgatt
gtggataatcctgatgaggcttttagtggtggggaacctaccaaattcggttctgttggc
accgatggcggtaaaaccggttaccatggttactggggcgttaatttctacaaggtcgat
gaacacctggagtccccggatctggcatttgcggactttacccgcatcctgcgtgaagac
tatgacctgaaatacgtattggacattgtggccaaccatggttcaccgtcttactccatg
ccggttagccaggcgtccatgggcaagctttatgacgagcagggcaggttggtggcagat
caccagaacctgtaccccgacaagctcgacccaaacaatcccctgcacaaatttttcaat
acccaacccggtttggcacagctttcggacatcaatgagaataatccggaagtcctggat
tattttgtgaattcctatttcaaatggattgaccagggtgcctatgccctgcgcgtcgat
accatcaaggaaatgccccatcacttctggaaaaaagtagcggatcgcattcgcgaacgt
catccggatatgtttatgttcggtgagagctattcctatgaagccagctttattgcacag
cacacccgtccggaaaatggtggatacagcgttttggatttccctgggcgccaggccata
accagtgtgtttgagaatgatgaaagcgactatgcttccattttgtcttatctccacctt
aaggatggtatgtaccagaacccgtatgaactggttaccttttatgataaccatgatatg
gcgcgtatgaatgcgtctgatcgcggtttcgtgaatgccaataactggctgtttaccagc
cgcggtattccctgtatttattatggttccgaagccaacttctccaccggcctgaaggag
catgagggtaatcgcaattattttggacaagcgcgtgtcaatgccgctaaaaaccatgtt
gttcacaacaacctgacccgcattgcccatgtgcgcaaggataatgtttccctgcagcgc
ggattgcaggttaacctggtgttcgcaggaaatattgccagcttctatcgcatctaccag
caggatggcgttaatcaaacggccctggtggtattgaataaaggtgaggccgcagagtcg
gttaccctggataagatgttgaatagcggtcagtggcgcgatgcgctcagtggcaagaaa
ctccaggtcagtaagaagcaaaaaagcctgaccctggatgttcctgccaatggtgtgcgt
gtattgttgctcgatgcacctatcactaaccctgacttgattgcagaagtgaagcactcc
atggctgcacttttttaa

DBGET integrated database retrieval system