KEGG   Cellvibrio japonicus: CJA_3306Help
Entry
CJA_3306          CDS       T00721                                 

Gene name
gly30A
Definition
glycoside hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cja  Cellvibrio japonicus
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CJA_3306 (gly30A)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CJA_3306 (gly30A)
Enzymes [BR:cja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CJA_3306 (gly30A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3955656..3957098
Genome map
AA seq 480 aa AA seqDB search
MNLIFRTAFLASALISANVTQAVDTGPQKTLQVYTTAKDTKLRLTLSDKLSLKPAQQAPE
TDTAIFVNPDKRYQTLLGIGGAITDASAEVYATLDQKTQREFMQAYYDQDKGLGYSLLRT
TIHSSDFASSSYTYIEEGDKALNTFDITPDKKHRIPMIKQAIRAAGGSITTYASPWSAPA
FMKDTNNMLQGGKLLPEYRDTWATYFTKFIRAYEQEGIPIWGITVQNEPMAKQTWESMIF
TAEEERDFLKNHLGPIMHTSGLGDKKIIVWDHNRDLITHRANTILSDPEAAKYVWGVGFH
WYETWTGGQPMFGNVAEVKQAFPHINLLLTEATVEKFDAARYHHWPNAERYGNSIVNDFN
AGAAGWTDWNMLLDDKGGPNHVSNFCFAPIHADSKTGKLIYTPTYYYLGHFSRFIRPEAQ
RVSAVSSRSVLQTTSFINADNQLATVVLNLSDAAVTYRFYIGTQETTVTIPARAIQTLVY
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttatttttcgcaccgcctttttggccagcgcgcttatcagcgccaatgttacc
caggccgtggacaccggcccgcaaaaaaccttgcaggtctacaccaccgccaaagacaca
aaattgcgtctcaccttgagcgataaactctcgctcaaacccgcgcaacaggcgccggaa
accgacaccgccattttcgtcaacccggacaagcgctaccaaaccctgctcggtattggc
ggcgctatcaccgatgccagcgccgaggtgtatgcaacactcgatcaaaaaacgcagcgg
gaatttatgcaggcttactatgaccaggacaagggtctgggctacagcctgctgcgcacc
accatccacagctccgactttgccagcagcagctacacctatatcgaagagggcgacaaa
gcgcttaacacctttgatataacgccggataaaaaacaccgcatccccatgatcaagcag
gccatccgggccgccggcggcagcatcaccacctacgccagcccctggagcgcaccggcg
tttatgaaagacaccaacaatatgctgcaaggcggcaagctgctgcccgaataccgcgac
acctgggccacctacttcaccaaatttatccgcgcctatgagcaggaaggcattccgatt
tgggggattaccgtacaaaacgaacccatggccaagcaaacctgggaatcgatgattttc
accgcggaagaagagcgcgatttcctcaaaaaccacctgggcccgatcatgcacacatcc
ggcctgggcgataaaaaaatcatcgtgtgggatcacaaccgcgacctgatcacgcaccgc
gccaacaccatcctcagcgatcccgaagcggctaaatatgtctggggcgtgggcttccac
tggtacgaaacctggaccggcggccaacccatgttcggcaacgtggccgaagtcaagcag
gcattcccgcatatcaacctgctgctcaccgaagccacggtggaaaaatttgatgcggcg
cgctaccaccactggcccaatgccgaacgctacggcaactccatcgtcaatgacttcaac
gccggcgcggcaggctggaccgactggaatatgctgctggacgataaaggcggccccaac
catgtcagcaatttctgcttcgcccccattcacgccgacagcaaaaccggcaagctgatt
tacaccccgacctattactacctcggccacttctcgcgctttatccgccctgaggcgcag
cgggtcagtgcggtcagcagccgcagcgtgctgcaaaccacgtcgtttatcaacgccgat
aaccaactggcaacggtggtcttgaatttaagcgatgccgccgtgacctatcgcttttat
ataggcacacaggaaaccaccgttactatccccgcgcgcgccatccaaacgctggtgtat
taa

DBGET integrated database retrieval system