KEGG   Cellvibrio japonicus: CJA_3472Help
Entry
CJA_3472          CDS       T00721                                 

Definition
(GenBank) GGDEF domain protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
cja  Cellvibrio japonicus
Brite
Enzymes [BR:cja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     CJA_3472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4167284..4168822)
Genome map
AA seq 512 aa AA seqDB search
MLVRVSLAAEGQDEALDQLMVQLRERLRKDKAADIGDLLGRLEASAIALEQQRDHISLSV
RESLAQVLKPWQGAALSRSLKRDISDYLAQLPKRSKKIRLYPALLQQLADLQQQAFSQIE
QPKTGLLQRLIGAKNTASADDAAGVLLPLENSHLPESPITAAQSDATELWFGKLLALINE
FLESLEQDDQWREPVQQLRQELSASDSIEAALGSLRQVRSLVMEAYLSANRAFADYLDRV
NRELAEISTLLGGAVQSSYAGQEASAQLQAQVIQEMTSLEQQAEEATDLVQLKQRVQSQL
GSIRQALDRFQQTEQAQQQLAVQLNSLGEKIKIMEAEAEQNRTTLEQQRFKALHDALTEL
PNREAYNERARAEVQRWERYGRPLAIAIIDIDHFKKINDNYGHQAGDRVIKVIGRSIAKR
LREVDFFCRYGGEEFVALMPETSGDNALIVLEKIRDAIARAAFNYKEQPLQITISAGLTE
FKPGDTLDSAFERADQALYAAKSNGRNATQQV
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtgagggtcagtttggcagctgaagggcaggatgaagccctcgatcaattgatg
gtgcagctgcgcgagcgcttgcgcaaagataaggccgccgatatcggcgatctgctgggg
cgattggaagcatctgccattgcactggagcaacagcgcgaccatatcagcctgagtgtg
cgtgaatccctggcccaggtgttaaagccctggcagggggctgcgctgagccgatcattg
aaacgggatatcagcgattacctggcacaactgcccaagcgcagcaaaaagatccggtta
taccccgcgctcttgcagcagcttgccgatttgcaacagcaggccttttcccagattgag
cagcccaaaacgggcttactgcagcgtctaattggtgcgaaaaataccgcgtcggctgat
gatgcggccggggtgttgctcccgctagaaaatagccacttacctgaatcacccataact
gcggcgcagagcgatgccaccgagttgtggttcggaaaattgttggcacttatcaatgag
ttcctggaaagcctggagcaggacgatcaatggcgcgagcctgtacagcagcttcgtcaa
gagttgtcagcgtctgactctatagaggcggcactgggctccttgcgccaggtgcgcagc
ctggtgatggaagcttacctctctgccaaccgggcgtttgccgattacctggatcgagtc
aatcgtgagctggccgaaatctcaaccctgctggggggcgccgtgcagtcatcctacgct
ggacaagaggcctcagcccagttgcaggcgcaggtgatacaggaaatgactagcctggag
cagcaggcggaagaggcgacggacctggttcaattgaagcaacgggttcagtcccaattg
gggagtattcgccaggcgctggatcgcttccaacagacggagcaagcgcagcagcagttg
gcggtacagctcaatagcctgggtgaaaagatcaaaatcatggaagcggaagcagagcag
aatcgcacaaccctggagcaacagcgcttcaaggccctgcacgatgcgctcacagaactg
cctaaccgtgaggcctataacgagcgagccagggcggaggtccagcgctgggagcgctat
ggtcgtcccctggcaatcgcgattatagatattgaccatttcaaaaagattaatgacaac
tatggtcaccaggccggtgatcgggtcattaaagtcattgggcgatctattgccaagcgt
ttgcgtgaagtggattttttctgccgctacggcggtgaagaatttgtggcgctaatgccg
gaaacatcaggcgataacgccttgatagtattggaaaaaatacgcgatgctatcgcccgt
gccgccttcaattacaaggagcaacctttgcagattacgatctcggcaggactgacagag
tttaagccgggagataccctggactctgcctttgaacgtgcggatcaggccctgtatgca
gccaaaagcaacggacgcaatgctacgcaacaggtttag

DBGET integrated database retrieval system