KEGG   Cellvibrio japonicus: CJA_3472Help
Entry
CJA_3472          CDS       T00721                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
cja  Cellvibrio japonicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4167284..4168822)
Genome map
AA seq 512 aa AA seqDB search
MLVRVSLAAEGQDEALDQLMVQLRERLRKDKAADIGDLLGRLEASAIALEQQRDHISLSV
RESLAQVLKPWQGAALSRSLKRDISDYLAQLPKRSKKIRLYPALLQQLADLQQQAFSQIE
QPKTGLLQRLIGAKNTASADDAAGVLLPLENSHLPESPITAAQSDATELWFGKLLALINE
FLESLEQDDQWREPVQQLRQELSASDSIEAALGSLRQVRSLVMEAYLSANRAFADYLDRV
NRELAEISTLLGGAVQSSYAGQEASAQLQAQVIQEMTSLEQQAEEATDLVQLKQRVQSQL
GSIRQALDRFQQTEQAQQQLAVQLNSLGEKIKIMEAEAEQNRTTLEQQRFKALHDALTEL
PNREAYNERARAEVQRWERYGRPLAIAIIDIDHFKKINDNYGHQAGDRVIKVIGRSIAKR
LREVDFFCRYGGEEFVALMPETSGDNALIVLEKIRDAIARAAFNYKEQPLQITISAGLTE
FKPGDTLDSAFERADQALYAAKSNGRNATQQV
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtgagggtcagtttggcagctgaagggcaggatgaagccctcgatcaattgatg
gtgcagctgcgcgagcgcttgcgcaaagataaggccgccgatatcggcgatctgctgggg
cgattggaagcatctgccattgcactggagcaacagcgcgaccatatcagcctgagtgtg
cgtgaatccctggcccaggtgttaaagccctggcagggggctgcgctgagccgatcattg
aaacgggatatcagcgattacctggcacaactgcccaagcgcagcaaaaagatccggtta
taccccgcgctcttgcagcagcttgccgatttgcaacagcaggccttttcccagattgag
cagcccaaaacgggcttactgcagcgtctaattggtgcgaaaaataccgcgtcggctgat
gatgcggccggggtgttgctcccgctagaaaatagccacttacctgaatcacccataact
gcggcgcagagcgatgccaccgagttgtggttcggaaaattgttggcacttatcaatgag
ttcctggaaagcctggagcaggacgatcaatggcgcgagcctgtacagcagcttcgtcaa
gagttgtcagcgtctgactctatagaggcggcactgggctccttgcgccaggtgcgcagc
ctggtgatggaagcttacctctctgccaaccgggcgtttgccgattacctggatcgagtc
aatcgtgagctggccgaaatctcaaccctgctggggggcgccgtgcagtcatcctacgct
ggacaagaggcctcagcccagttgcaggcgcaggtgatacaggaaatgactagcctggag
cagcaggcggaagaggcgacggacctggttcaattgaagcaacgggttcagtcccaattg
gggagtattcgccaggcgctggatcgcttccaacagacggagcaagcgcagcagcagttg
gcggtacagctcaatagcctgggtgaaaagatcaaaatcatggaagcggaagcagagcag
aatcgcacaaccctggagcaacagcgcttcaaggccctgcacgatgcgctcacagaactg
cctaaccgtgaggcctataacgagcgagccagggcggaggtccagcgctgggagcgctat
ggtcgtcccctggcaatcgcgattatagatattgaccatttcaaaaagattaatgacaac
tatggtcaccaggccggtgatcgggtcattaaagtcattgggcgatctattgccaagcgt
ttgcgtgaagtggattttttctgccgctacggcggtgaagaatttgtggcgctaatgccg
gaaacatcaggcgataacgccttgatagtattggaaaaaatacgcgatgctatcgcccgt
gccgccttcaattacaaggagcaacctttgcagattacgatctcggcaggactgacagag
tttaagccgggagataccctggactctgcctttgaacgtgcggatcaggccctgtatgca
gccaaaagcaacggacgcaatgctacgcaacaggtttag

DBGET integrated database retrieval system