KEGG   Cellvibrio japonicus: CJA_3524Help
Entry
CJA_3524          CDS       T00721                                 

Gene name
algC
Definition
(GenBank) phosphomannomutase AlgC
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cja  Cellvibrio japonicus
Pathway
cja00010  Glycolysis / Gluconeogenesis
cja00030  Pentose phosphate pathway
cja00051  Fructose and mannose metabolism
cja00052  Galactose metabolism
cja00230  Purine metabolism
cja00500  Starch and sucrose metabolism
cja00520  Amino sugar and nucleotide sugar metabolism
cja00521  Streptomycin biosynthesis
cja01100  Metabolic pathways
cja01110  Biosynthesis of secondary metabolites
cja01120  Microbial metabolism in diverse environments
cja01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJA_3524 (algC)
   00030 Pentose phosphate pathway
    CJA_3524 (algC)
   00051 Fructose and mannose metabolism
    CJA_3524 (algC)
   00052 Galactose metabolism
    CJA_3524 (algC)
   00500 Starch and sucrose metabolism
    CJA_3524 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    CJA_3524 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    CJA_3524 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CJA_3524 (algC)
Enzymes [BR:cja01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CJA_3524 (algC)
    5.4.2.8  phosphomannomutase
     CJA_3524 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV FtsL
Motif
Other DBs
NCBI-ProteinID: ACE86337
UniProt: B3PG70
Position
4212688..4215195
Genome map
AA seq 835 aa AA seqDB search
MDNKPDSPEKIKSESKAALRAQEASKRKAALQRKILLSLGAIALLASAVISWWLHGQLVV
TKQQERLNQLTQMEADNRKMLLESYLRTQTQTVDRLAANQDFIDSLTPEHPSNTPEQRDT
LTRQWLRATPGALSVRLFELHSAELDRNAEYPIRFAEMDLIRRAETRQTIQPELVQINDR
WQINWARPIAVDNSSDPLGSLFIVIDASELLNLFQGGDKRLGEIQLIQQFAGSAPLIVLK
QGTGNAGPSVQVQVAGSALQLKFTPSSELVAMSAELPSLWIMISALITAALLALALLASK
FLVRLELGKAPQEPALSDLVPAHKPASSASEESVANPLFHKQDILDIAVIDEDEDVLGLG
GSRGKKTSGLTNTQMSEDDIPRDIFRSYDIRGLVGSQLTPELALKIGQAIGSEALDQGEQ
SLIVARDGRTHSANLTQALIKGILKSGCNVINIGVVPTPLMYFASFQFEDTRSGVMVTAS
HNPKEYNGFKVVINNEALADEAVLDLRARIIGQRLHQGLGEEFPRDIIPAYIERIFSDVA
LAGNVSLVIDAGNAVTGLVAPQLFEELGCDVTPLFCDLDGEFPNHNPDPTEEKNLSALIA
KVQETGADMGVAFDGDGDRLVVVTPKGDIIWPDRMLMLFARDILARHPGADVLFDVKCSR
QLNQVISSYGGRPIMWKTGHSPMKAKMVETGALIGGEYSGHIFIKDRWYGFDDGLYAMAR
LLEIITLRDQKIDDIFASFPPMVITPELKIPSSDRNKFALIEKLQAQGDFQNGAITTIDG
LRVDFPKGWGLVRASNTSPALTLRFEAESQEMLVKIQQLFKRELLKVDSSLALPF
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
gtggataacaaacccgactcacccgaaaagattaaaagtgaatccaaggccgcgctgcgc
gcccaggaagccagcaaacgcaaagcagctttgcagcgcaaaatcctcttgagcctgggg
gctatcgccctgctggcaagtgctgttatcagctggtggctgcatggacaattggtggtt
accaagcagcaggagcgtctaaaccagctgacgcagatggaagcggacaaccgcaaaatg
ctgctggaaagttatttgcgcacccagacccaaactgttgatcgcctggccgccaaccag
gactttatcgatagcctcaccccggaacaccccagcaacacaccggaacagcgcgataca
ctcacccgccaatggctgcgcgccacaccaggggcattgagcgtgcgcctgtttgagttg
cacagtgcagagctggatcgcaacgcggagtatcctattcgctttgcggaaatggatctg
attcgccgcgccgaaacgcgccagacaatccaacccgagctggtacaaatcaacgaccga
tggcaaatcaattgggcgcgtcccatcgcggttgataacagcagcgatccactgggcagc
ctttttatcgttattgatgccagcgaattgctcaatctttttcagggaggggacaagcga
ctgggcgaaatccaactcattcaacaattcgcgggcagcgcaccgctgattgtcctgaag
cagggcacaggcaatgccggccccagtgtccaggtgcaagttgccggtagtgcgttacaa
ctcaaattcacgccgtcctccgaattagtggctatgtctgcagagctgcccagcctctgg
attatgatcagtgcgttgatcaccgctgcactcctggcgctcgccttactcgccagtaaa
ttcctggttcgcctcgaactgggcaaagcgccgcaagagccggcactcagtgatttggtg
cccgcacataaaccagccagcagcgccagcgaagaaagcgtagccaatcccttattccac
aagcaggacatcctggatattgccgtcatcgatgaagatgaggatgtactcggcctgggc
ggcagtcgcggtaaaaaaaccagcggcctcaccaacacccaaatgagtgaggatgacatt
ccgcgggatattttccgctcttacgatatccgtggcttggtcggcagccagctcaccccg
gaactggccctgaaaattggccaggccattggcagcgaagcgctggatcagggtgagcaa
agcctgattgttgcgcgcgacgggcgcacccacagcgcaaacctgacccaggcgctgatc
aagggtatcctcaaatctggctgtaacgttatcaacataggtgtcgtgcccacaccattg
atgtatttcgccagcttccagtttgaagacacccgcagtggtgtcatggtaacggccagc
cacaatcccaaggaatataacggttttaaagtggtgattaacaacgaggcgctggccgac
gaagcggtactcgacctgcgcgcacgtattatcggccagcgattacatcagggactgggc
gaggagttcccgcgcgacattatccccgcgtatatcgagcgcattttctcggatgtcgcc
ctggccggtaatgtttcgctggttattgacgccggcaatgccgttaccggtttggttgca
ccgcaattgttcgaggaattgggatgtgatgtgacgcccctgttttgcgatctcgatggc
gaattccccaatcacaacccggatcccaccgaagaaaaaaacctcagcgcattaattgcc
aaggtgcaggaaaccggtgccgatatgggcgtggctttcgatggcgatggcgatcgactg
gttgtcgttacccccaagggcgatattatctggccagatcggatgctgatgctgtttgca
cgcgatatactcgcgcgccatccgggggccgatgtgctcttcgatgtgaaatgctcacgc
cagctcaaccaggtgatcagcagctacggcggccggccgatcatgtggaaaaccggccac
tcaccgatgaaagccaaaatggtcgaaaccggagctctcattggcggggaatattccggc
catatttttatcaaggatcgctggtatggttttgacgatggcctttacgccatggcacgt
ttgctggaaatcatcaccctgcgcgaccagaagatcgatgatatttttgccagtttcccc
cccatggtcattaccccggaattaaaaatcccgagcagtgaccgcaacaagttcgcgctt
atcgaaaaattgcaggcacagggcgatttccagaatggcgccattaccaccatcgatggt
ttgcgcgtggatttccccaagggctggggcctggtgcgcgcctccaatacatcgccggca
ctgacgttgcgctttgaggcggaaagccaggaaatgctggtcaagatccaacaattgttt
aaacgcgagctgcttaaagtcgatagtagccttgcgctccctttttaa

DBGET integrated database retrieval system