KEGG   Cellvibrio japonicus: CJA_3569Help
Entry
CJA_3569          CDS       T00721                                 

Definition
(GenBank) guanylate kinase (GMP kinase)
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cja  Cellvibrio japonicus
Pathway
cja00230  Purine metabolism
cja01100  Metabolic pathways
Module
cja_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cja00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CJA_3569
Enzymes [BR:cja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CJA_3569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 MMR_HSR1 DUF3658
Motif
Other DBs
NCBI-ProteinID: ACE84675
UniProt: B3PGX4
Position
4263640..4264665
Genome map
AA seq 341 aa AA seqDB search
MESTNNPYDVVWSPRAVISTRVAIPFWRNFSISCASLSTSAASSCSPWIKLRRCLATNSR
TYSGRTRRRSAVWVMESSWRNMVNLHNRVGSITMPQIVPQGADFALIGAIRLKQGQSCAI
ILLSLSHLPRNKALFMANLGTLYTVSAPSGAGKTSLVSALVKSNPEVCVSVSHTTRAMRP
GELNGVNYHFVDHATFEAMLEQGEFLESARVFSNLYGTSQKWVMDTLAQGLDVILEIDWQ
GAQQVRKLIPGTISLFILPPSLACLRQRLTGRGQDADNVIEARMAEAISEMSHYVEADYL
IINDDFTTALAQFQALITAQHIRREAQVQRHTQLLQDLLGN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcacgaacaatccttatgatgttgtctggtcaccgcgagcagtgatttccacc
agggtggcaatccccttctggcgcaatttttccatcagttgtgccagcctctccacctct
gcggcatccagttgctcaccgtggataaaactcaggcgctgtttggctaccaattcgcgg
acatactcggggcgcacacgcagacgctctgcggtttgggtgatggaaagcagctggcgc
aacatggtaaacctgcacaatcgggtgggtagtatcactatgccacagattgtgccccag
ggcgcagactttgccctgataggagccatcaggctgaagcagggacaaagctgtgccata
attttgctttccctttctcacttgccccgaaataaggcgttgttcatggctaatcttggc
actctttataccgtttcggcgccctcaggcgccggcaaaaccagcctggtcagtgcgctg
gttaaatccaatcccgaggtttgcgtttctgtgtcccacaccacccgcgccatgcgcccg
ggcgagctcaatggtgttaattatcactttgtggatcacgccactttcgaggccatgctg
gagcagggcgagtttctggaatcggcccgggtattcagtaacctctacggcacctcgcag
aaatgggtgatggataccctggctcaggggttggatgtcatcctcgaaattgactggcag
ggtgcccagcaggtgcgcaagctgattcccggcacgatcagtttgtttattctgccgcca
tcactcgcctgcctgcgccagcgcctgaccggtcgcggccaggatgcagacaacgtgatt
gaagcgcgcatggctgaggctatcagcgaaatgtcccactatgttgaggcagactacctg
atcatcaatgatgatttcaccaccgccctggcacaattccaggctctgattaccgcccaa
catattcgccgcgaggcacaggttcagcgccatacccaattgctgcaggatttattgggc
aactaa

DBGET integrated database retrieval system