KEGG   Cellvibrio japonicus: CJA_3651Help
Entry
CJA_3651          CDS       T00721                                 

Definition
putative restriction endonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
cja  Cellvibrio japonicus
Brite
Enzymes [BR:cja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     CJA_3651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4373742..4376429)
Genome map
AA seq 895 aa AA seqDB search
METTIWLTEVAPQIGKNGQRFLDHLADANANANPELIRLALKLATGAGKTTVMAMLIAWQ
TVNAVRRPNSKKFTRGFLIVAPGLTIKDRLRVLQPNDPDSYYASRELVPADMLEDLQKAK
IVITNYHAFKLRERMEISKGGRLLLQGRTGEALNTLETEGQMLQRVMPELMGMKNILAIN
DEAHHCYREKPEEETEEGDLKGDDKTEAQKNNEAARLWISGLEAVNRKLGLTQVIDLSAT
PFFLRGSGYAEGTLFPWTMSDFSLMDAIECGIVKLPRVPVADNIPGQDMPVFRNLWEHIG
KDMPKKGRGKAADLDPLKLPTPLQTALQALYGHYEKTFNLWQQAGIRVPPCFIVVCNNTA
TSKLVYDYISGFQRQNDDDTSSLVEGRLPLFRNHDDYGNPLPRPNTLLIDSEQLESGEAL
DTNFREFAADEIERFRREIIERSGDPRAADNLTDQDLLREVMNTVGKRDTLGGDIRCVVS
VSMLTEGWDANTVTHVLGVRAFGTQLLCEQVIGRALRRQSYELNEQGRFNTEYADVLGIP
FDFTAKPVIAKPQPPRETIQVKAVRPERDHLAITFPRVAGYRVELADERLSAEFTEDSTL
VLTPLLVGPSITRNAGIIGEGVDLNLIHTRDLRQSTLLFHLAQHLMLRHWRDPGEEPKLH
LFGQLKRIAKQWLDKHLDCKGETYPAQLMYLELADRACEKITHAINRAGIQQGSAVVKAV
LDPYNPTGSTAYVNFSTSKTDRWETLGPPPKNHLNWVILDSDWEAEFCRVAESHPWVHSY
VKNHNLGLEVPYQMGGTNHQYRPDYIVRIDDGRGPDDLLNLIVEIKGYRGEDAKAKKETM
ETRWIPGVNRLGTQGRWAFAEFTDIWTMQDDFAEKVQEAFDNMLNTYQKNGQNKE
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaccatctggctcaccgaggtagccccgcaaatcggcaaaaacggccagcga
ttcctcgaccacctggccgatgccaacgccaatgccaacccggaactcatacgccttgcc
ctcaaactggccacgggcgccggtaaaaccacggtcatggccatgctgattgcctggcag
acggtcaatgctgtgcgccgccccaacagcaaaaaatttacccgtggttttttgattgtc
gcaccagggctgaccatcaaggaccgcctgcgcgtactgcaacccaacgacccggacagt
tactacgccagccgcgagttagtgccggcggatatgctggaagacctgcaaaaagccaaa
atcgtcatcaccaactatcacgccttcaaactgcgtgaacgcatggaaatatccaaaggc
ggccgcctgctgttgcaaggtcgcactggtgaagcactcaataccctggaaaccgaaggt
cagatgctgcaacgggtcatgcctgaacttatgggtatgaaaaatatcctcgccatcaac
gacgaagcccatcattgttaccgcgaaaaaccggaagaggaaaccgaggaaggcgacctg
aaaggtgatgacaaaaccgaggcgcaaaaaaataacgaagccgcgcgcctgtggatttct
ggcctcgaagccgtcaaccgaaaactgggcttgacacaggttatcgacctttccgcaacc
ccgttttttctgcgcggttccggctacgccgaaggcacactctttccctggaccatgagc
gatttctcgttgatggacgctattgaatgcggcattgtcaaactgccccgtgtacctgta
gcggacaacattcccggccaggacatgccggtattccgcaacctctgggaacatatcggc
aaagacatgcccaaaaaaggccggggcaaggccgccgacctggacccgctcaaactgccg
acaccactgcaaacagcgctacaagccctctacggccattacgaaaagactttcaaccta
tggcagcaggctggtatccgcgtaccaccctgttttatcgtggtctgcaacaacaccgcc
acctccaagctggtgtacgactatatttccggtttccagcggcaaaacgatgacgatacc
agctccctggtggaaggccgcctgcctctgttccgcaaccacgacgactacggcaatcca
ctgccacgccccaacaccctgctgatcgacagtgaacaactggagtccggcgaggcactg
gataccaacttccgcgaattcgccgccgacgaaatcgagcgtttccgccgggaaatcatc
gagcgcagtggtgatcctcgtgcagcagataacctcaccgaccaggatttactgcgcgaa
gtcatgaacaccgtgggcaaacgcgacaccctgggcggcgacatccgctgcgtggtctcc
gtctccatgctcaccgagggttgggatgccaacaccgtcacccatgtactcggtgtgcgt
gcattcggcacccagcttttatgcgagcaggtcattggccgggcactgcgccgccagtcc
tacgaactcaacgaacaggggcggttcaacacagaatacgccgacgtactcggcatcccc
ttcgatttcacagccaagccggtcatcgccaaaccccaaccgccacgcgagacgatacaa
gtcaaagccgtgcgccccgaacgcgatcatctggcgatcacctttccccgcgtcgcgggc
tacagggtggaactggccgatgaacgcctgagcgcggagttcaccgaggattccaccctg
gtactcaccccgctactggtcggcccctccataacccgcaacgccggcattatcggcgaa
ggtgtcgatctcaacctgattcacacccgcgacctgcgccaatccaccctgctgttccac
ctggcccaacacctgatgctgcgccactggcgcgaccccggtgaagaacccaagctgcac
ctgttcggccaactcaaacgcatcgccaaacaatggctggacaagcatctcgattgcaaa
ggtgaaacctatccggcccagttgatgtacctggaactggccgaccgcgcctgcgaaaaa
atcacccacgccatcaaccgcgcgggcattcagcagggcagtgcggtcgtcaaggcagtg
ctcgacccctacaaccccaccggcagcacagcctacgtcaacttcagcacctccaaaacc
gaccgctgggaaacccttgggccgcctcctaaaaaccatctcaactgggtcattctggac
agtgactgggaagccgaattctgtcgcgtggccgaaagccacccatgggtacacagctac
gtcaaaaatcacaacctggggctggaagtgccctaccagatgggcggcaccaaccaccaa
taccgccccgactatatcgtacgcatcgacgatggcagaggccccgatgacctgctcaac
ctgatcgtggaaatcaagggttaccggggcgaagacgccaaggccaaaaaagaaactatg
gaaacccgctggatacccggcgtgaaccgcctgggcacccagggccgctgggcctttgct
gaatttaccgacatctggacaatgcaggacgattttgctgaaaaggtgcaggaggctttt
gataatatgctgaacacctaccagaaaaatggccaaaacaaggagtga

DBGET integrated database retrieval system